KEGG   Bacillus megaterium WSH-002: BMWSH_1407Help
Entry
BMWSH_1407        CDS       T01890                                 

Gene name
gpmA
Definition
phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bmh  Bacillus megaterium WSH-002
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bmh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BMWSH_1407 (gpmA)
   01230 Biosynthesis of amino acids
    BMWSH_1407 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BMWSH_1407 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    BMWSH_1407 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BMWSH_1407 (gpmA)
Enzymes [BR:bmh01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BMWSH_1407 (gpmA)
Exosome [BR:bmh04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BMWSH_1407 (gpmA)
  Exosomal proteins of melanoma cells
   BMWSH_1407 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1428780..1429340
Genome map
AA seq 186 aa AA seqDB search
MKTFLLVRHCEAEGQEAKASLTEQGTQQAQQLMDYLNKLSYPIDKIISSPYKRAVQTIEP
YAKDTGLPLHIDTRIEERRLSGKPLFNWIEVLKRTFDDIDFKVDGGESTKEATVRALELF
KEVMNEKQKTTLFVTHGNLMTLILRHFDPRFGFNEWSCLTNPDVYRIDLEKKNVSITRLW
NEKKIN
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacttttttattagttaggcattgtgaagcagaagggcaagaagcaaaagcatca
ctgacggaacaaggcacacagcaagctcagcagttaatggattatttgaacaagctgagt
tatcctattgataaaattatttcaagtccgtacaaacgagccgttcaaacaattgaacct
tatgcaaaagataccggtctgcctcttcatatagatacaaggatagaagaaaggcgttta
agcggaaagcctcttttcaactggatagaagtattgaaaagaacttttgatgacatagac
tttaaggtagacggaggagaatcgaccaaagaagccacggtacgtgctttagaactgttt
aaagaagtaatgaacgaaaaacagaaaacgactctgtttgttacgcacggcaatttgatg
acattaatccttagacattttgatccgaggtttggatttaatgagtggtcatgtttaacg
aaccctgatgtgtaccgaattgatcttgaaaagaagaacgtttccattacaaggctctgg
aatgagaagaaaataaattga

DBGET integrated database retrieval system