KEGG   Bacillus megaterium WSH-002: BMWSH_1407Help
Entry
BMWSH_1407        CDS       T01890                                 

Gene name
gpmA
Definition
(GenBank) Phosphoglycerate mutase family protein
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bmh  Bacillus megaterium WSH-002
Pathway
bmh00010  Glycolysis / Gluconeogenesis
bmh00260  Glycine, serine and threonine metabolism
bmh00680  Methane metabolism
bmh01100  Metabolic pathways
bmh01110  Biosynthesis of secondary metabolites
bmh01120  Microbial metabolism in diverse environments
bmh01130  Biosynthesis of antibiotics
bmh01200  Carbon metabolism
bmh01230  Biosynthesis of amino acids
Module
bmh_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bmh_M00002  Glycolysis, core module involving three-carbon compounds
bmh_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bmh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BMWSH_1407 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    BMWSH_1407 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BMWSH_1407 (gpmA)
Enzymes [BR:bmh01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BMWSH_1407 (gpmA)
Membrane trafficking [BR:bmh04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    BMWSH_1407 (gpmA)
Exosome [BR:bmh04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BMWSH_1407 (gpmA)
  Exosomal proteins of melanoma cells
   BMWSH_1407 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 DUF4130
Motif
Other DBs
NCBI-ProteinID: AEN88291
UniProt: G2RL05
Position
1428780..1429340
Genome map
AA seq 186 aa AA seqDB search
MKTFLLVRHCEAEGQEAKASLTEQGTQQAQQLMDYLNKLSYPIDKIISSPYKRAVQTIEP
YAKDTGLPLHIDTRIEERRLSGKPLFNWIEVLKRTFDDIDFKVDGGESTKEATVRALELF
KEVMNEKQKTTLFVTHGNLMTLILRHFDPRFGFNEWSCLTNPDVYRIDLEKKNVSITRLW
NEKKIN
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacttttttattagttaggcattgtgaagcagaagggcaagaagcaaaagcatca
ctgacggaacaaggcacacagcaagctcagcagttaatggattatttgaacaagctgagt
tatcctattgataaaattatttcaagtccgtacaaacgagccgttcaaacaattgaacct
tatgcaaaagataccggtctgcctcttcatatagatacaaggatagaagaaaggcgttta
agcggaaagcctcttttcaactggatagaagtattgaaaagaacttttgatgacatagac
tttaaggtagacggaggagaatcgaccaaagaagccacggtacgtgctttagaactgttt
aaagaagtaatgaacgaaaaacagaaaacgactctgtttgttacgcacggcaatttgatg
acattaatccttagacattttgatccgaggtttggatttaatgagtggtcatgtttaacg
aaccctgatgtgtaccgaattgatcttgaaaagaagaacgtttccattacaaggctctgg
aatgagaagaaaataaattga

DBGET integrated database retrieval system