KEGG   Bacillus megaterium WSH-002: BMWSH_1781Help
Entry
BMWSH_1781        CDS       T01890                                 

Gene name
fbp
Definition
fructose-1,6-bisphosphatase class 3
Orthology
K04041  
fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
bmh  Bacillus megaterium WSH-002
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bmh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BMWSH_1781 (fbp)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BMWSH_1781 (fbp)
   00030 Pentose phosphate pathway
    BMWSH_1781 (fbp)
   00051 Fructose and mannose metabolism
    BMWSH_1781 (fbp)
  Energy metabolism
   00680 Methane metabolism
    BMWSH_1781 (fbp)
Enzymes [BR:bmh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     BMWSH_1781 (fbp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1735837..1737420
Genome map
AA seq 527 aa AA seqDB search
MLNLISYASSKYTRSKLRKALPNQFVYIIEELLYKTDEFTNKEQYYTKIVQQIISLGQAD
KLIIGLAYTTQRLVVDHLHVVGDIYDRGPEPDKIMDTLINYHSVDIQWGNHDVLWLGAFA
GSKVCLANIIRICARYDNLDIIEDVYGINLRPLLNLAEKYYDDNPAFRPKVSSSDKLSDH
ERLQITKIHQAIAMIQFKLESPIIKRRPFFNMSERLLLEKIDYDKNEITIYGNTYPLENS
CFATVNPEQPDQLLEEEEQVMERLLLSVQHSEKLARHMKFLMKKGSLYLKYNGNLLIHGC
IPLDEEGNMEKMTIEDKTYAGRNLLDVFEHYLQEAFAHPEETDDLATDMVWYLWTGEYSS
LFGKRAMTTFERYFISDKTTHKEKKNPYYYLRENEEVCQNILAEFNLNPDHGHIINGHTP
VKEIEGENPVKANGKMIVIDGGFSKAYQSTTGIAGYTLLYNSYGMQLVAHKHFNSKEDIL
LEGTDVLSVKRLVDKELERKMVLETNVGEELLKEISILKDLRKYRYS
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgcttaatcttatttcgtacgcttcttctaaatacacgcgttctaaactgcgtaaagca
ttgccaaatcaatttgtgtacattattgaagagctgctatacaaaacggatgaatttaca
aataaagaacagtactatacaaagattgttcagcagattatttctctgggacaagccgat
aagcttattatagggcttgcttatacgacgcaaagattggttgtggaccacctgcacgta
gtgggggatatttatgaccggggacctgaaccggataaaattatggatacgctgattaac
tatcactccgttgatattcagtggggaaatcacgatgtgctatggctaggcgcttttgcg
ggttcgaaagtgtgtctcgccaatattattcgtatctgcgcgagatacgacaatctagat
attattgaagacgtatatggcattaacctgagaccgctgcttaacttggcggagaaatat
tatgatgataatcctgcttttagaccaaaagtaagctcgagtgacaaactatccgatcac
gagcgactacaaattacgaaaattcaccaggccattgcgatgattcagttcaagcttgaa
agtccgattatcaaaagacgtcctttctttaatatgtcagaaaggctgttgcttgaaaaa
attgattatgataaaaatgaaattacgatatacggaaacacgtatccgctagaaaacagc
tgctttgcaacggttaaccccgagcagcctgatcagctattagaagaagaagagcaggta
atggaaagactgctgctttctgtacagcactcagaaaagctggcgagacatatgaagttt
ctgatgaaaaaaggcagcctatacttgaaatataacggaaacttattaatacacggctgc
attcctttagatgaagaaggaaacatggaaaaaatgacgatagaagataaaacgtatgca
ggccgtaacttgcttgatgtgtttgaacattatttacaagaggcttttgcacatcctgaa
gaaacggatgatttggcaacagatatggtctggtacctatggacaggagaatattcatca
ctctttgggaaacgcgccatgacgacgtttgaacgatattttatcagtgataaaacaacg
cataaagagaagaagaatccatactactatttacgggaaaatgaggaagtctgccaaaac
atcctcgcagaatttaatttgaatcctgatcatggtcatattattaatggtcatacgcca
gtcaaagaaatcgaaggagaaaatccggtcaaagcaaatggaaagatgattgttattgac
ggcggtttttcaaaagcgtatcaatccacaacaggtatcgctggatacacgttgttatat
aattcttacggcatgcagctagttgcgcacaaacactttaattcaaaagaagatatttta
ttagaaggaacggacgttttatccgtaaaacgattggtcgacaaagaactagaaagaaag
atggttctagaaacaaacgtcggagaagaattattaaaagaaatttctattttaaaagat
ttacgaaagtatcgctatagttaa

DBGET integrated database retrieval system