KEGG   Bacillus megaterium WSH-002: BMWSH_1781Help
Entry
BMWSH_1781        CDS       T01890                                 

Gene name
fbp
Definition
fructose-1,6-bisphosphatase class 3
Orthology
K04041  
fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
bmh  Bacillus megaterium WSH-002
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:bmh01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bmh00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:bmh00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:bmh00051]
Metabolism; Energy metabolism; Methane metabolism [PATH:bmh00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1735837..1737420
Genome map
AA seq 527 aa AA seqDB search
MLNLISYASSKYTRSKLRKALPNQFVYIIEELLYKTDEFTNKEQYYTKIVQQIISLGQAD
KLIIGLAYTTQRLVVDHLHVVGDIYDRGPEPDKIMDTLINYHSVDIQWGNHDVLWLGAFA
GSKVCLANIIRICARYDNLDIIEDVYGINLRPLLNLAEKYYDDNPAFRPKVSSSDKLSDH
ERLQITKIHQAIAMIQFKLESPIIKRRPFFNMSERLLLEKIDYDKNEITIYGNTYPLENS
CFATVNPEQPDQLLEEEEQVMERLLLSVQHSEKLARHMKFLMKKGSLYLKYNGNLLIHGC
IPLDEEGNMEKMTIEDKTYAGRNLLDVFEHYLQEAFAHPEETDDLATDMVWYLWTGEYSS
LFGKRAMTTFERYFISDKTTHKEKKNPYYYLRENEEVCQNILAEFNLNPDHGHIINGHTP
VKEIEGENPVKANGKMIVIDGGFSKAYQSTTGIAGYTLLYNSYGMQLVAHKHFNSKEDIL
LEGTDVLSVKRLVDKELERKMVLETNVGEELLKEISILKDLRKYRYS
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgcttaatcttatttcgtacgcttcttctaaatacacgcgttctaaactgcgtaaagca
ttgccaaatcaatttgtgtacattattgaagagctgctatacaaaacggatgaatttaca
aataaagaacagtactatacaaagattgttcagcagattatttctctgggacaagccgat
aagcttattatagggcttgcttatacgacgcaaagattggttgtggaccacctgcacgta
gtgggggatatttatgaccggggacctgaaccggataaaattatggatacgctgattaac
tatcactccgttgatattcagtggggaaatcacgatgtgctatggctaggcgcttttgcg
ggttcgaaagtgtgtctcgccaatattattcgtatctgcgcgagatacgacaatctagat
attattgaagacgtatatggcattaacctgagaccgctgcttaacttggcggagaaatat
tatgatgataatcctgcttttagaccaaaagtaagctcgagtgacaaactatccgatcac
gagcgactacaaattacgaaaattcaccaggccattgcgatgattcagttcaagcttgaa
agtccgattatcaaaagacgtcctttctttaatatgtcagaaaggctgttgcttgaaaaa
attgattatgataaaaatgaaattacgatatacggaaacacgtatccgctagaaaacagc
tgctttgcaacggttaaccccgagcagcctgatcagctattagaagaagaagagcaggta
atggaaagactgctgctttctgtacagcactcagaaaagctggcgagacatatgaagttt
ctgatgaaaaaaggcagcctatacttgaaatataacggaaacttattaatacacggctgc
attcctttagatgaagaaggaaacatggaaaaaatgacgatagaagataaaacgtatgca
ggccgtaacttgcttgatgtgtttgaacattatttacaagaggcttttgcacatcctgaa
gaaacggatgatttggcaacagatatggtctggtacctatggacaggagaatattcatca
ctctttgggaaacgcgccatgacgacgtttgaacgatattttatcagtgataaaacaacg
cataaagagaagaagaatccatactactatttacgggaaaatgaggaagtctgccaaaac
atcctcgcagaatttaatttgaatcctgatcatggtcatattattaatggtcatacgcca
gtcaaagaaatcgaaggagaaaatccggtcaaagcaaatggaaagatgattgttattgac
ggcggtttttcaaaagcgtatcaatccacaacaggtatcgctggatacacgttgttatat
aattcttacggcatgcagctagttgcgcacaaacactttaattcaaaagaagatatttta
ttagaaggaacggacgttttatccgtaaaacgattggtcgacaaagaactagaaagaaag
atggttctagaaacaaacgtcggagaagaattattaaaagaaatttctattttaaaagat
ttacgaaagtatcgctatagttaa

DBGET integrated database retrieval system