KEGG   Bacillus megaterium WSH-002: BMWSH_1945Help
Entry
BMWSH_1945        CDS       T01890                                 

Gene name
cypD
Definition
NADPH--cytochrome P450 reductase
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
bmh  Bacillus megaterium WSH-002
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Class
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:bmh00071]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:bmh00380]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:bmh00627]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1863137..1866286
Genome map
AA seq 1049 aa AA seqDB search
MTIKEMPQPKTFGELKNLPLLNTDKPIQTLMKIADELGEIFKFEAPGRVTRYLSSQRLIK
EACDESRFDKNLSQALKFVRDFAGDGLFTSWTHEKNWKKAHNILLPSFSQQAMKGYHAMM
VDIAVQLIQKWERLNADEHIEVPEDMTRLTLDTIGLCGFNYRFNSFYRDQPHPFITSMVR
ALDEAMNKLQRANPDDPAYDENKRQFQEDIKVMNDLVDKIIADRKASGEQSDDLLTHMLN
GKDPETGEPLDDENIRYQIITFLIAGHETTSGLLSFALYFLVKNPHVLQKAAEEAARVLV
DPVPSYKQVKQLKYVGMVLNEALRLWPTAPAFSLYAKEDTVLGGEYPLEKGDELMVLIPQ
LHRDKTIWGDDVEEFRPERFENPSAIPQHAFKPFGNGQRACIGQQFALHEATLVLGMMLK
HFDFEDHTNYELDIKETLTLKPEGFVVKAKSKKIPLGGIPSLSTEQSAKKVRKKVENAHN
TPLLVLYGSNMGTAEGTARDLADIAMSKGFAPQVATLDSHAGNLPREGAVLIVTASYNGH
PPDNAKEFVDWLDQASADEVKGVRYSVFGCGDKNWATTYQKVPAFIDETLAAKGAENIAE
RGEADASDDFEGTYEEWREHMWSDVAAYFNLDIENSEDNKSTLSLQFVDSAADMPLAKMH
GAFSANVVASKELQQPGSERSTRHLEIELPKEASYQEGDHLGVIPRNYEGIVNRVATRFG
LDASQQIRLEAEEEKLAHLPLGKTVSVEELLQYVELQDPVTRTQLRAMAAKTVCPPHKVE
LEALLEKQTYKEQVLAKRLTMLELLEKYPACEMEFSEFIALLPSMRPRYYSISSSPRVDE
KQASITVSVVSGEAWSGYGEYKGIASNYLAELQEGDTITCFISTPQSGFALPKDSQTPII
MVGPGTGVAPFRGFVQARKQLKEQGQSLGEAHLYFGCRSPHEDYLYQEELENAQNEGIIT
LHTAFSRVPNQPKTYVQHVMEQDGTKLIELLDQGAHFYICGDGSQMAPDVEATLIKSYAD
VHEVSEADARLWLQQLEEKGRYAKDVWAG
NT seq 3150 nt NT seq  +upstreamnt  +downstreamnt
atgacaattaaagagatgcctcagccaaaaacgtttggagagcttaaaaatttaccgtta
ttaaacaccgataaacccattcaaacgttgatgaaaattgcggatgaattaggagaaatc
tttaaatttgaagcacctggccgcgtgacgcgctacttatcaagtcagcgtctaattaaa
gaagcatgcgatgaatcacgctttgataaaaacttaagtcaagcgcttaaatttgtacgt
gattttgcaggagacggtttatttacaagttggactcatgagaaaaactggaaaaaagca
cacaacatcttacttccaagctttagccagcaagcgatgaaaggctatcacgcgatgatg
gtcgatatcgccgtgcagcttattcaaaagtgggagcgtctaaatgcagatgagcatatt
gaagtaccggaagatatgacgcgcttaacgcttgatacaatcggtctttgtggatttaac
taccgctttaacagcttttaccgcgatcagcctcatccatttattacaagcatggtacgt
gcgctagatgaagcgatgaacaagctgcagcgagcaaatcctgatgacccggcttatgat
gaaaataagcgccagtttcaagaagacattaaggtaatgaacgatctagtagataaaatt
attgcagatcgcaaagcaagcggtgaacaaagcgatgatttattaacgcatatgctaaac
ggcaaagatccagaaacaggtgaaccgcttgatgacgaaaatattcgctatcaaattatt
acgttcttaattgcaggacatgaaacaacaagcggtcttttatcatttgcgctgtatttc
ttagtgaaaaatccacacgtattacaaaaagcagcagaagaagcagcacgagttctcgtc
gatcctgttccaagctacaaacaagtcaagcagcttaaatatgtgggcatggtcttaaac
gaagcgctgcgcctatggccaacggctcctgctttttctctatatgctaaagaagatacg
gtgcttggaggagaatatcctttagaaaaaggtgatgaactgatggttctgattcctcag
cttcaccgtgataaaacgatttggggagacgatgtagaagagttccgcccagagcgtttt
gaaaacccaagcgcaattccgcagcatgcgtttaaaccgtttggaaacggtcagcgtgcg
tgtatcggtcagcagttcgctcttcatgaagcaacgcttgtacttggtatgatgctaaaa
cattttgactttgaagatcatacaaattacgagctagatataaaagagactttaacgtta
aaacctgaaggctttgtggtaaaagcaaaatcgaaaaaaattcctcttggtggtattcca
tcacttagcactgaacagtctgctaaaaaagtgcgcaaaaaggtagaaaacgctcataat
acgccgcttcttgtgctatacggttcaaatatgggaacagccgaaggaacggcgcgtgat
ttagcggatattgcgatgagcaaaggattcgcgccgcaggtcgcaacgcttgattcccac
gcaggaaaccttccgcgtgaaggagctgttttaattgtaacggcttcttataacggtcat
ccgcctgataacgcaaaggaatttgttgactggttagaccaagcgtctgctgatgaagta
aaaggcgtgcgctactccgtatttggatgcggtgataaaaactgggcgacaacgtatcaa
aaagtgcctgcttttattgatgaaacgcttgccgctaaaggggcagaaaacatagctgaa
cgcggtgaagcagatgcaagcgacgactttgaaggcacgtacgaagaatggcgtgaacat
atgtggagtgacgtagcagcctactttaacctcgacattgaaaacagtgaagataataaa
tctacgctttcacttcaatttgtcgacagcgctgcggacatgccgcttgcgaaaatgcac
ggtgcgttttcagcgaacgtcgtagcaagcaaagaacttcaacagccaggcagtgaacga
agcacgcgtcatcttgaaattgaacttccaaaagaagcttcttatcaagaaggagatcat
ttaggcgttattcctcgcaactatgaaggaatagtaaatcgtgtagcaacaagattcggt
ctagatgcatcacagcaaatccgtttggaagctgaagaagaaaaattagcgcatttacca
ctcggtaaaaccgtatcagtagaagagcttcttcaatacgtggagcttcaagatcctgtt
acgcgcacgcagcttcgcgcaatggctgctaaaacagtctgcccgccgcataaagtggag
cttgaggccttgcttgaaaagcaaacgtacaaagaacaagttctggcaaaacgtttaacg
atgcttgaactgcttgaaaaatatccggcgtgtgaaatggaattcagcgaatttatcgcc
cttcttccaagcatgcgtccgcgttactactcaatttcttcatcacctcgcgtcgatgaa
aaacaagcaagcatcacggtcagcgttgtctctggagaagcgtggagcgggtatggagag
tacaaaggaattgcgtcgaactatcttgctgagctgcaagaaggagatacaattacgtgc
tttatttccacaccgcagtcaggctttgcgctgccaaaagactctcaaacaccgattatc
atggtcggaccgggaacaggcgtcgcgccgtttagaggctttgtgcaggctcgcaagcag
ttaaaagaacaaggacagtcgcttggagaagcgcatttatactttggctgccgttcacct
catgaagactatctttatcaagaagaacttgaaaatgcacaaaatgaaggcatcattacg
cttcacactgctttttctcgcgtaccaaatcagccgaaaacatacgttcagcacgtgatg
gaacaagacggcacgaaattgattgaacttcttgatcaaggagcgcacttctatatttgc
ggagacggaagccaaatggcacctgacgttgaagcaacgcttattaaaagctatgctgat
gttcatgaagtgagtgaagcagacgctcgcttatggctgcagcagctagaagaaaagggc
cgatacgcaaaagacgtgtgggctgggtaa

DBGET integrated database retrieval system