KEGG   Bacillus megaterium WSH-002: BMWSH_1945Help
Entry
BMWSH_1945        CDS       T01890                                 

Gene name
cypD
Definition
NADPH--cytochrome P450 reductase
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
bmh  Bacillus megaterium WSH-002
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bmh00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    BMWSH_1945 (cypD)
  Amino acid metabolism
   00380 Tryptophan metabolism
    BMWSH_1945 (cypD)
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BMWSH_1945 (cypD)
Enzymes [BR:bmh01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     BMWSH_1945 (cypD)
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     BMWSH_1945 (cypD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1863137..1866286
Genome map
AA seq 1049 aa AA seqDB search
MTIKEMPQPKTFGELKNLPLLNTDKPIQTLMKIADELGEIFKFEAPGRVTRYLSSQRLIK
EACDESRFDKNLSQALKFVRDFAGDGLFTSWTHEKNWKKAHNILLPSFSQQAMKGYHAMM
VDIAVQLIQKWERLNADEHIEVPEDMTRLTLDTIGLCGFNYRFNSFYRDQPHPFITSMVR
ALDEAMNKLQRANPDDPAYDENKRQFQEDIKVMNDLVDKIIADRKASGEQSDDLLTHMLN
GKDPETGEPLDDENIRYQIITFLIAGHETTSGLLSFALYFLVKNPHVLQKAAEEAARVLV
DPVPSYKQVKQLKYVGMVLNEALRLWPTAPAFSLYAKEDTVLGGEYPLEKGDELMVLIPQ
LHRDKTIWGDDVEEFRPERFENPSAIPQHAFKPFGNGQRACIGQQFALHEATLVLGMMLK
HFDFEDHTNYELDIKETLTLKPEGFVVKAKSKKIPLGGIPSLSTEQSAKKVRKKVENAHN
TPLLVLYGSNMGTAEGTARDLADIAMSKGFAPQVATLDSHAGNLPREGAVLIVTASYNGH
PPDNAKEFVDWLDQASADEVKGVRYSVFGCGDKNWATTYQKVPAFIDETLAAKGAENIAE
RGEADASDDFEGTYEEWREHMWSDVAAYFNLDIENSEDNKSTLSLQFVDSAADMPLAKMH
GAFSANVVASKELQQPGSERSTRHLEIELPKEASYQEGDHLGVIPRNYEGIVNRVATRFG
LDASQQIRLEAEEEKLAHLPLGKTVSVEELLQYVELQDPVTRTQLRAMAAKTVCPPHKVE
LEALLEKQTYKEQVLAKRLTMLELLEKYPACEMEFSEFIALLPSMRPRYYSISSSPRVDE
KQASITVSVVSGEAWSGYGEYKGIASNYLAELQEGDTITCFISTPQSGFALPKDSQTPII
MVGPGTGVAPFRGFVQARKQLKEQGQSLGEAHLYFGCRSPHEDYLYQEELENAQNEGIIT
LHTAFSRVPNQPKTYVQHVMEQDGTKLIELLDQGAHFYICGDGSQMAPDVEATLIKSYAD
VHEVSEADARLWLQQLEEKGRYAKDVWAG
NT seq 3150 nt NT seq  +upstreamnt  +downstreamnt
atgacaattaaagagatgcctcagccaaaaacgtttggagagcttaaaaatttaccgtta
ttaaacaccgataaacccattcaaacgttgatgaaaattgcggatgaattaggagaaatc
tttaaatttgaagcacctggccgcgtgacgcgctacttatcaagtcagcgtctaattaaa
gaagcatgcgatgaatcacgctttgataaaaacttaagtcaagcgcttaaatttgtacgt
gattttgcaggagacggtttatttacaagttggactcatgagaaaaactggaaaaaagca
cacaacatcttacttccaagctttagccagcaagcgatgaaaggctatcacgcgatgatg
gtcgatatcgccgtgcagcttattcaaaagtgggagcgtctaaatgcagatgagcatatt
gaagtaccggaagatatgacgcgcttaacgcttgatacaatcggtctttgtggatttaac
taccgctttaacagcttttaccgcgatcagcctcatccatttattacaagcatggtacgt
gcgctagatgaagcgatgaacaagctgcagcgagcaaatcctgatgacccggcttatgat
gaaaataagcgccagtttcaagaagacattaaggtaatgaacgatctagtagataaaatt
attgcagatcgcaaagcaagcggtgaacaaagcgatgatttattaacgcatatgctaaac
ggcaaagatccagaaacaggtgaaccgcttgatgacgaaaatattcgctatcaaattatt
acgttcttaattgcaggacatgaaacaacaagcggtcttttatcatttgcgctgtatttc
ttagtgaaaaatccacacgtattacaaaaagcagcagaagaagcagcacgagttctcgtc
gatcctgttccaagctacaaacaagtcaagcagcttaaatatgtgggcatggtcttaaac
gaagcgctgcgcctatggccaacggctcctgctttttctctatatgctaaagaagatacg
gtgcttggaggagaatatcctttagaaaaaggtgatgaactgatggttctgattcctcag
cttcaccgtgataaaacgatttggggagacgatgtagaagagttccgcccagagcgtttt
gaaaacccaagcgcaattccgcagcatgcgtttaaaccgtttggaaacggtcagcgtgcg
tgtatcggtcagcagttcgctcttcatgaagcaacgcttgtacttggtatgatgctaaaa
cattttgactttgaagatcatacaaattacgagctagatataaaagagactttaacgtta
aaacctgaaggctttgtggtaaaagcaaaatcgaaaaaaattcctcttggtggtattcca
tcacttagcactgaacagtctgctaaaaaagtgcgcaaaaaggtagaaaacgctcataat
acgccgcttcttgtgctatacggttcaaatatgggaacagccgaaggaacggcgcgtgat
ttagcggatattgcgatgagcaaaggattcgcgccgcaggtcgcaacgcttgattcccac
gcaggaaaccttccgcgtgaaggagctgttttaattgtaacggcttcttataacggtcat
ccgcctgataacgcaaaggaatttgttgactggttagaccaagcgtctgctgatgaagta
aaaggcgtgcgctactccgtatttggatgcggtgataaaaactgggcgacaacgtatcaa
aaagtgcctgcttttattgatgaaacgcttgccgctaaaggggcagaaaacatagctgaa
cgcggtgaagcagatgcaagcgacgactttgaaggcacgtacgaagaatggcgtgaacat
atgtggagtgacgtagcagcctactttaacctcgacattgaaaacagtgaagataataaa
tctacgctttcacttcaatttgtcgacagcgctgcggacatgccgcttgcgaaaatgcac
ggtgcgttttcagcgaacgtcgtagcaagcaaagaacttcaacagccaggcagtgaacga
agcacgcgtcatcttgaaattgaacttccaaaagaagcttcttatcaagaaggagatcat
ttaggcgttattcctcgcaactatgaaggaatagtaaatcgtgtagcaacaagattcggt
ctagatgcatcacagcaaatccgtttggaagctgaagaagaaaaattagcgcatttacca
ctcggtaaaaccgtatcagtagaagagcttcttcaatacgtggagcttcaagatcctgtt
acgcgcacgcagcttcgcgcaatggctgctaaaacagtctgcccgccgcataaagtggag
cttgaggccttgcttgaaaagcaaacgtacaaagaacaagttctggcaaaacgtttaacg
atgcttgaactgcttgaaaaatatccggcgtgtgaaatggaattcagcgaatttatcgcc
cttcttccaagcatgcgtccgcgttactactcaatttcttcatcacctcgcgtcgatgaa
aaacaagcaagcatcacggtcagcgttgtctctggagaagcgtggagcgggtatggagag
tacaaaggaattgcgtcgaactatcttgctgagctgcaagaaggagatacaattacgtgc
tttatttccacaccgcagtcaggctttgcgctgccaaaagactctcaaacaccgattatc
atggtcggaccgggaacaggcgtcgcgccgtttagaggctttgtgcaggctcgcaagcag
ttaaaagaacaaggacagtcgcttggagaagcgcatttatactttggctgccgttcacct
catgaagactatctttatcaagaagaacttgaaaatgcacaaaatgaaggcatcattacg
cttcacactgctttttctcgcgtaccaaatcagccgaaaacatacgttcagcacgtgatg
gaacaagacggcacgaaattgattgaacttcttgatcaaggagcgcacttctatatttgc
ggagacggaagccaaatggcacctgacgttgaagcaacgcttattaaaagctatgctgat
gttcatgaagtgagtgaagcagacgctcgcttatggctgcagcagctagaagaaaagggc
cgatacgcaaaagacgtgtgggctgggtaa

DBGET integrated database retrieval system