KEGG   Bacillus megaterium WSH-002: BMWSH_2279Help
Entry
BMWSH_2279        CDS       T01890                                 

Gene name
odhB
Definition
2-oxoglutarate dehydrogenase complex (Dihydrolipoamide transsuccinylase, E2 subunit)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bmh  Bacillus megaterium WSH-002
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bmh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BMWSH_2279 (odhB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BMWSH_2279 (odhB)
  Amino acid metabolism
   00310 Lysine degradation
    BMWSH_2279 (odhB)
Enzymes [BR:bmh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BMWSH_2279 (odhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2145102..2146397
Genome map
AA seq 431 aa AA seqDB search
MGEIKVPELAESISEGTVAQWLKQVGDFVEKGDYIVELETDKVNVEITAEDSGVLTELLA
GEGDTVQVGETIARLEAKEGASAPAAPKAEEKPAEEAPKQEAAPAQQKTVEEVAPAAEAP
QQGNQKQWLIASPAARKAARERGIKLDQVPTTDPLGRVRKHDIDSYADQKSNEQKQQAQA
SKPANPVSPSPAASENSDKPVERERMSRRRQTIAKRLVEVQQTAAMLTTFNEVDMTAVMA
LRKRRKDKFFEQHDVRLGFMSFFTKAVVAALKKYPLLNAEIQGNELLIKKFYDIGIAVSA
PDGLVVPVVRDADRKTFAGIEGSIVDLAKKARDNKLALKDLQGGTFTITNGGVFGSLMST
PILNGPQVGILGMHKVQLRPVAIDEERIENRPMMYIALSYDHRIVDGKEAVSFLATVKEL
LEDPESLLLEG
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgggagagattaaagtaccggaattagcagaatcaatttctgaaggaacagttgcacag
tggctaaaacaagtaggagatttcgttgaaaaaggcgattatatcgttgaacttgaaaca
gataaagttaacgttgaaattacagctgaagactctggtgtgttaacggaacttcttgct
ggcgaaggcgacacagtgcaagttggtgaaacaattgcacgtcttgaagcgaaagaagga
gcttcagcaccagcagcaccaaaagctgaagaaaaaccagcagaggaagcaccaaagcaa
gaagcggctccagctcagcaaaaaactgttgaagaagtagcgccagcagctgaagcgcct
cagcaaggaaatcaaaaacaatggctaattgcttctcctgcagcgcgcaaagcagcaaga
gaacgtgggattaagctagatcaagtgccaactactgatcctcttggccgtgtgcgcaaa
catgatattgattcgtatgcagaccaaaaatcaaatgagcaaaagcagcaggcacaagca
agtaagccagctaacccggtatctccgtctccagcggcaagtgaaaatagcgacaaacct
gttgaacgcgagcgtatgtcacgtcgtcgtcaaacaattgccaaacgtcttgttgaagtt
cagcaaacagcggctatgctgacaacgtttaacgaagtagacatgacggctgttatggct
cttcgcaaacgacgcaaagacaaattctttgaacagcacgacgtaagacttggctttatg
tcattctttacaaaagcagtagtagcagcacttaaaaagtatccattattaaatgctgaa
attcaaggcaacgagttattaattaaaaaattctatgatatcggtattgctgtgtcagct
ccagacggtcttgttgttccagttgtacgtgatgctgaccgtaaaacattcgctggtatc
gaaggatctatcgttgatttagcgaaaaaagcgcgcgacaacaaattagcattaaaagat
ttacaaggtggaacgttcacaattacaaacggcggcgtcttcggttcattaatgtctaca
ccaattttaaacggacctcaagttggtatcttaggaatgcataaagttcagcttcgtccg
gtagcaattgatgaagagcgtatcgaaaatcgtccgatgatgtacattgcactttcttac
gatcaccgtatcgttgacgggaaagaagccgtaagcttcctagctactgttaaagaacta
ttagaagatccagaatctttattactagaaggttaa

DBGET integrated database retrieval system