KEGG   Bacillus megaterium WSH-002: BMWSH_2279Help
Entry
BMWSH_2279        CDS       T01890                                 

Gene name
odhB
Definition
2-oxoglutarate dehydrogenase complex (Dihydrolipoamide transsuccinylase, E2 subunit)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bmh  Bacillus megaterium WSH-002
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:bmh01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:bmh00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:bmh00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2145102..2146397
Genome map
AA seq 431 aa AA seqDB search
MGEIKVPELAESISEGTVAQWLKQVGDFVEKGDYIVELETDKVNVEITAEDSGVLTELLA
GEGDTVQVGETIARLEAKEGASAPAAPKAEEKPAEEAPKQEAAPAQQKTVEEVAPAAEAP
QQGNQKQWLIASPAARKAARERGIKLDQVPTTDPLGRVRKHDIDSYADQKSNEQKQQAQA
SKPANPVSPSPAASENSDKPVERERMSRRRQTIAKRLVEVQQTAAMLTTFNEVDMTAVMA
LRKRRKDKFFEQHDVRLGFMSFFTKAVVAALKKYPLLNAEIQGNELLIKKFYDIGIAVSA
PDGLVVPVVRDADRKTFAGIEGSIVDLAKKARDNKLALKDLQGGTFTITNGGVFGSLMST
PILNGPQVGILGMHKVQLRPVAIDEERIENRPMMYIALSYDHRIVDGKEAVSFLATVKEL
LEDPESLLLEG
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgggagagattaaagtaccggaattagcagaatcaatttctgaaggaacagttgcacag
tggctaaaacaagtaggagatttcgttgaaaaaggcgattatatcgttgaacttgaaaca
gataaagttaacgttgaaattacagctgaagactctggtgtgttaacggaacttcttgct
ggcgaaggcgacacagtgcaagttggtgaaacaattgcacgtcttgaagcgaaagaagga
gcttcagcaccagcagcaccaaaagctgaagaaaaaccagcagaggaagcaccaaagcaa
gaagcggctccagctcagcaaaaaactgttgaagaagtagcgccagcagctgaagcgcct
cagcaaggaaatcaaaaacaatggctaattgcttctcctgcagcgcgcaaagcagcaaga
gaacgtgggattaagctagatcaagtgccaactactgatcctcttggccgtgtgcgcaaa
catgatattgattcgtatgcagaccaaaaatcaaatgagcaaaagcagcaggcacaagca
agtaagccagctaacccggtatctccgtctccagcggcaagtgaaaatagcgacaaacct
gttgaacgcgagcgtatgtcacgtcgtcgtcaaacaattgccaaacgtcttgttgaagtt
cagcaaacagcggctatgctgacaacgtttaacgaagtagacatgacggctgttatggct
cttcgcaaacgacgcaaagacaaattctttgaacagcacgacgtaagacttggctttatg
tcattctttacaaaagcagtagtagcagcacttaaaaagtatccattattaaatgctgaa
attcaaggcaacgagttattaattaaaaaattctatgatatcggtattgctgtgtcagct
ccagacggtcttgttgttccagttgtacgtgatgctgaccgtaaaacattcgctggtatc
gaaggatctatcgttgatttagcgaaaaaagcgcgcgacaacaaattagcattaaaagat
ttacaaggtggaacgttcacaattacaaacggcggcgtcttcggttcattaatgtctaca
ccaattttaaacggacctcaagttggtatcttaggaatgcataaagttcagcttcgtccg
gtagcaattgatgaagagcgtatcgaaaatcgtccgatgatgtacattgcactttcttac
gatcaccgtatcgttgacgggaaagaagccgtaagcttcctagctactgttaaagaacta
ttagaagatccagaatctttattactagaaggttaa

DBGET integrated database retrieval system