KEGG   Bacillus megaterium WSH-002: BMWSH_2294Help
Entry
BMWSH_2294        CDS       T01890                                 

Definition
BAAT/Acyl-CoA thioester hydrolase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
bmh  Bacillus megaterium WSH-002
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2161331..2162104
Genome map
AA seq 257 aa AA seqDB search
MERYDVIQGAESFYYKGNDIGILVSHGFMGTPQSMEYIGKELAEKGFTVYGLRLTGHGTH
YYDIEQTTYEEWKQDFLNGYQRLEQECRHVFILGQSMGGTLTFHTASQGLDLDGVIAINP
AMTSIPSMEPYRSRHTPRYLKEEHPDIKDPNVHEITYDKVPVRSMRELLSLMDETKERLS
YVTCPALVLTSTVDNVVPPENSAYILNHIQSAEKRQHMLRNSYHVASMDFDKDTIVAQTA
QFVQATVAKKKVHERIF
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggaacgttatgacgtaattcaaggcgcagaatctttttattataaaggcaacgacatt
ggtatacttgtttctcacggatttatggggactcctcaaagtatggaatatatcggaaaa
gaattagctgaaaaaggttttactgtgtacggtttgcgactaacgggacatggtactcac
tactatgatattgaacaaacaacgtacgaggaatggaagcaagactttttaaatgggtat
cagcgtttggagcaagaatgccgtcatgtatttatcttgggtcagtccatgggaggcact
ctcacctttcatacagcaagccaaggattagatcttgacggagttattgcaatcaatccg
gctatgacgtccattccttcaatggagccttaccgctctcgtcatacgcctcgttattta
aaagaagagcatcctgatattaaagatccaaacgtacatgaaattacgtacgacaaagta
ccagtgcgctctatgcgtgagctgctttctttaatggacgaaacaaaagaacgcttatct
tatgtaacgtgcccggctttagtactaacatcaaccgttgataacgtagtaccgcctgag
aattcagcttatatcttaaaccatattcaatcagcagaaaaaagacagcacatgcttcga
aactcttaccatgttgcgtcgatggattttgataaagacacaattgttgcacaaacggca
cagtttgtacaagcaacagttgccaaaaaaaaagtgcatgagcgaattttttaa

DBGET integrated database retrieval system