KEGG   Bacillus megaterium WSH-002: BMWSH_2316Help
Entry
BMWSH_2316        CDS       T01890                                 

Definition
Malate synthase G
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
bmh  Bacillus megaterium WSH-002
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bmh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BMWSH_2316
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BMWSH_2316
   00630 Glyoxylate and dicarboxylate metabolism
    BMWSH_2316
Enzymes [BR:bmh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     BMWSH_2316
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2176477..2178654
Genome map
AA seq 725 aa AA seqDB search
MTNYKQVGNLKVAPVLYQFINEEALPGSGLSTENFWSDFEALVTELTPVNKRLLEKRDQL
QAQINAWHQENPDGDFNEYKSFLTRIDYLEDKTEDFLIGTEGVDSEIAYQAGPQLVVPVN
NARYAINAANARWGSLYDALYGTDAISEENGASRTSSYNPIRGEKVIAFAKNFLDEIVPL
VQSSHAEVVQYSLENGRLVAQLNDGSLTELQEEEKFVGYQGEEESPDALLFKNNGLHFEV
QIDRTDSIGKTDDAGVKDILMEAALTTIMDCEDSVAAVDAEDKVDVYRNWLGLMKGDLTS
TFKKGSQNMTRRLNPDRTYISPDKEKISLSGRSLMFVRNVGHLMTNSAVLDRDGNEIYEG
ILDSVITSLIAKHTLLKNGTYQNSKKSSIYIVKPKMHGSKEVAFANTLFNSIEDMLGLER
HTIKIGVMDEERRTTLNLKACIKEVKDRVAFINTGFLDRTGDEIHTSMEAGAVIRKNDMK
ASKWLQGYEQSNVNVGLASGFQGRAQIGKGMWAMPDMMAEMLKQKVGHLKAGANTAWVPS
PTAATLHALHYHQIDVRDVQNELLTRSTDLQDDILQIPVAEKPNWSKDEIQQELDNNAQG
ILGYVVRWVDQGVGCSKVPDINNVGLMEDRATLRISSQHVANWLHHGICTKEQVTETLKR
MAKVVDQQNENDPLYQPMAPNYSTSIAFQAACDLVFQGYDQPNGYTEPILHRRRIEAKAK
AAIKQ
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
gtgacaaactataaacaagttggaaatctgaaagtagccccagttctctatcaatttatc
aatgaggaagctcttccgggcagcggcctaagtacagaaaatttttggtctgattttgaa
gcgttagtaactgagttaacacccgtaaataaacgcttgttagaaaagcgtgatcagctg
caagctcaaattaatgcgtggcatcaagaaaatcctgacggtgactttaacgaatacaaa
tcgtttttaacgagaattgactatttagaagacaagacagaagattttcttattggtaca
gaaggagtagacagtgaaattgcttatcaggcaggaccacagcttgttgtaccagtgaat
aacgcccggtatgctattaacgctgctaatgcacgctggggaagtctctatgatgctctt
tacggcactgatgcaatcagtgaagaaaatggagcttcgcgcacgagttcttacaatcca
attcgaggagaaaaagttattgcgtttgcgaagaattttcttgatgaaattgttccgctc
gttcagtcttctcatgcggaagtggttcagtacagccttgaaaatggaaggcttgtcgct
caattaaatgatggcagtttaacagaattacaggaagaagagaaatttgtagggtatcaa
ggagaagaagaaagccctgatgctcttttattcaaaaacaacggcctgcattttgaagtt
caaattgatcgtacggattcgattggtaaaacagacgatgcgggtgtaaaagatatttta
atggaagcagctcttacgacgattatggactgtgaagattcagtagcggcagtagacgca
gaagataaagtagatgtttaccgcaactggctaggattaatgaaaggtgatttgacgtct
acttttaaaaaaggaagtcaaaacatgacaaggcgtttgaatccagaccgtacctatatt
tctcccgacaaggaaaagatttcactgtctggccgttcgcttatgtttgttcgaaacgtt
gggcatttaatgacaaacagcgctgttttagatcgagatggcaacgaaatctatgaaggt
attttagacagcgtgattactagtttaattgccaaacacaccttgcttaaaaacggtacg
tatcaaaattctaaaaagagctctatctatatcgttaaaccgaaaatgcacggctccaaa
gaagtggcttttgccaacacgttatttaattcaattgaagatatgctagggcttgagcgt
catacgattaaaattggcgtaatggacgaagagcgccgcacaacgcttaatttaaaagcg
tgcatcaaagaagtaaaagatcgagtggcttttattaatactggattcttggatcgaaca
ggtgatgaaattcacacttctatggaagcaggcgctgttattcgtaaaaatgatatgaag
gcgtctaaatggcttcaaggctacgagcagtctaatgtaaatgtaggattagcaagcgga
ttccaaggccgcgctcaaatcggaaaaggaatgtgggcaatgccggatatgatggccgaa
atgctgaaacaaaaagtggggcatttaaaagcaggagcgaatacggcatgggtgccttca
ccaaccgcagcaacgcttcatgctcttcactatcatcaaattgatgtaagagatgttcaa
aacgaattgcttactcggtctactgatttacaagatgacattttgcaaattcctgtggca
gaaaaaccaaattggagcaaagatgaaattcagcaggagctcgacaacaacgctcaagga
atacttggttatgtagtaagatgggttgaccaaggagtagggtgctcaaaagtaccggat
attaataacgtcgggctaatggaagaccgggcaacgcttcgtatttccagtcagcacgta
gctaactggcttcatcatgggatttgtacaaaggaacaagtaacggaaacattaaagcga
atggcaaaagtagtggatcaacaaaatgaaaatgatcctctatatcagccaatggcacca
aactacagcacatccattgcttttcaggcagcctgcgatttagtatttcaaggctatgat
cagccaaacggctatacggaacccattttacaccgccgccgtatcgaagcaaaagcaaaa
gcagctataaaacagtaa

DBGET integrated database retrieval system