KEGG   Bacillus megaterium WSH-002: BMWSH_2316Help
Entry
BMWSH_2316        CDS       T01890                                 

Definition
Malate synthase G
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
bmh  Bacillus megaterium WSH-002
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:bmh01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:bmh00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:bmh00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2176477..2178654
Genome map
AA seq 725 aa AA seqDB search
MTNYKQVGNLKVAPVLYQFINEEALPGSGLSTENFWSDFEALVTELTPVNKRLLEKRDQL
QAQINAWHQENPDGDFNEYKSFLTRIDYLEDKTEDFLIGTEGVDSEIAYQAGPQLVVPVN
NARYAINAANARWGSLYDALYGTDAISEENGASRTSSYNPIRGEKVIAFAKNFLDEIVPL
VQSSHAEVVQYSLENGRLVAQLNDGSLTELQEEEKFVGYQGEEESPDALLFKNNGLHFEV
QIDRTDSIGKTDDAGVKDILMEAALTTIMDCEDSVAAVDAEDKVDVYRNWLGLMKGDLTS
TFKKGSQNMTRRLNPDRTYISPDKEKISLSGRSLMFVRNVGHLMTNSAVLDRDGNEIYEG
ILDSVITSLIAKHTLLKNGTYQNSKKSSIYIVKPKMHGSKEVAFANTLFNSIEDMLGLER
HTIKIGVMDEERRTTLNLKACIKEVKDRVAFINTGFLDRTGDEIHTSMEAGAVIRKNDMK
ASKWLQGYEQSNVNVGLASGFQGRAQIGKGMWAMPDMMAEMLKQKVGHLKAGANTAWVPS
PTAATLHALHYHQIDVRDVQNELLTRSTDLQDDILQIPVAEKPNWSKDEIQQELDNNAQG
ILGYVVRWVDQGVGCSKVPDINNVGLMEDRATLRISSQHVANWLHHGICTKEQVTETLKR
MAKVVDQQNENDPLYQPMAPNYSTSIAFQAACDLVFQGYDQPNGYTEPILHRRRIEAKAK
AAIKQ
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
gtgacaaactataaacaagttggaaatctgaaagtagccccagttctctatcaatttatc
aatgaggaagctcttccgggcagcggcctaagtacagaaaatttttggtctgattttgaa
gcgttagtaactgagttaacacccgtaaataaacgcttgttagaaaagcgtgatcagctg
caagctcaaattaatgcgtggcatcaagaaaatcctgacggtgactttaacgaatacaaa
tcgtttttaacgagaattgactatttagaagacaagacagaagattttcttattggtaca
gaaggagtagacagtgaaattgcttatcaggcaggaccacagcttgttgtaccagtgaat
aacgcccggtatgctattaacgctgctaatgcacgctggggaagtctctatgatgctctt
tacggcactgatgcaatcagtgaagaaaatggagcttcgcgcacgagttcttacaatcca
attcgaggagaaaaagttattgcgtttgcgaagaattttcttgatgaaattgttccgctc
gttcagtcttctcatgcggaagtggttcagtacagccttgaaaatggaaggcttgtcgct
caattaaatgatggcagtttaacagaattacaggaagaagagaaatttgtagggtatcaa
ggagaagaagaaagccctgatgctcttttattcaaaaacaacggcctgcattttgaagtt
caaattgatcgtacggattcgattggtaaaacagacgatgcgggtgtaaaagatatttta
atggaagcagctcttacgacgattatggactgtgaagattcagtagcggcagtagacgca
gaagataaagtagatgtttaccgcaactggctaggattaatgaaaggtgatttgacgtct
acttttaaaaaaggaagtcaaaacatgacaaggcgtttgaatccagaccgtacctatatt
tctcccgacaaggaaaagatttcactgtctggccgttcgcttatgtttgttcgaaacgtt
gggcatttaatgacaaacagcgctgttttagatcgagatggcaacgaaatctatgaaggt
attttagacagcgtgattactagtttaattgccaaacacaccttgcttaaaaacggtacg
tatcaaaattctaaaaagagctctatctatatcgttaaaccgaaaatgcacggctccaaa
gaagtggcttttgccaacacgttatttaattcaattgaagatatgctagggcttgagcgt
catacgattaaaattggcgtaatggacgaagagcgccgcacaacgcttaatttaaaagcg
tgcatcaaagaagtaaaagatcgagtggcttttattaatactggattcttggatcgaaca
ggtgatgaaattcacacttctatggaagcaggcgctgttattcgtaaaaatgatatgaag
gcgtctaaatggcttcaaggctacgagcagtctaatgtaaatgtaggattagcaagcgga
ttccaaggccgcgctcaaatcggaaaaggaatgtgggcaatgccggatatgatggccgaa
atgctgaaacaaaaagtggggcatttaaaagcaggagcgaatacggcatgggtgccttca
ccaaccgcagcaacgcttcatgctcttcactatcatcaaattgatgtaagagatgttcaa
aacgaattgcttactcggtctactgatttacaagatgacattttgcaaattcctgtggca
gaaaaaccaaattggagcaaagatgaaattcagcaggagctcgacaacaacgctcaagga
atacttggttatgtagtaagatgggttgaccaaggagtagggtgctcaaaagtaccggat
attaataacgtcgggctaatggaagaccgggcaacgcttcgtatttccagtcagcacgta
gctaactggcttcatcatgggatttgtacaaaggaacaagtaacggaaacattaaagcga
atggcaaaagtagtggatcaacaaaatgaaaatgatcctctatatcagccaatggcacca
aactacagcacatccattgcttttcaggcagcctgcgatttagtatttcaaggctatgat
cagccaaacggctatacggaacccattttacaccgccgccgtatcgaagcaaaagcaaaa
gcagctataaaacagtaa

DBGET integrated database retrieval system