KEGG   Bacillus megaterium WSH-002: BMWSH_2953Help
Entry
BMWSH_2953        CDS       T01890                                 

Definition
hypothetical protein
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
bmh  Bacillus megaterium WSH-002
Pathway
Two-component system
Bacterial chemotaxis
Module
CheA-CheYBV (chemotaxis) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:bmh00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BMWSH_2953
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    BMWSH_2953
Enzymes [BR:bmh01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     BMWSH_2953
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     BMWSH_2953
Two-component system [BR:bmh02022]
 CheA family
  CheA-CheYBV
   BMWSH_2953
Bacterial motility proteins [BR:bmh02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    BMWSH_2953
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2765988..2769548
Genome map
AA seq 1186 aa AA seqDB search
MKNNSFSTVPSSTEGIEKQDLHVVGIGASAGGLEAIEQFFANMPSPNGMAFIIVQHLSSK
YKSFMPELLAKKTGMNIELTQDGMTLQEDTIYLNPPHHYVTVVDHTLHLRPYEENDQVKY
PIDAFFHSLAAAKKHRCTAIILSGKGNDGTGGAKTIREYGGTVLVQDESTAKYRDMPLSA
IDAHLADYILSPADMPDLVQTHVSQTEFTYNEETLQYIYSLIKKKTGIDFSMYKKNTVLR
RLEKRMALLDPPSQTMEEYRDYLCKEAEEIVELQRDLLIGVTQFLRDREAFSIIEEQVIP
QLVERKIHSQEDEIRIWVAGCSTGQEAYTLAILLHDYLSTINRYFDVRIFATDIDRHAIK
RASQGIYEEAEVHSFSASQINEYFEQTKHGGYQVKKTIRKMIVFAPHNIGKDSPFVNVDL
ISCRNMMIYFQAELQQRILSLFHFSLTEEGVLFLGPSETTGNLSDLFRPINSKWKIFKRS
GQSSRQITGAFNLSKSNLHEGDFSSVPLPSQLYKPLPSLKLDEMYQSMIDHFMSPCLVLN
EYNEVIFCSKEATQLINVPVGKINYTIFKMVPVHVSLAIGAAIKRVKEQGMSVCCQHIEF
VINNVQRRFNITISALPTNHSLYLLMFDEQTDGAIIDKEEPLFLNQTSSISELVVDLEQE
LHYTQQHLQTTIEELETANEELKSTNEELIASNEELQSTNEELQSVNEELISVNNQYERK
IEELTDLNNDIDNLLISTTIATIFLDEQLNIKLFTPETKTVINVLHQDIGRPFFHISHNF
RYDHLIEDAMHVLRTNNTLQKEIQSYDNQWYSMKMMPYRTNENLINGVVITFINITEIKR
SNEELAITSFAVAHSPTGIFITDHQGKIKYINQKFMEQKHAPQEVFGLHLYDLYTKKLGV
KRFPKIWNEVYRGEKWNGEISYVQEDGETVWEQLALMPVKNDQDEIIHYIGLSEDISQRK
QSEMMLKNSEMLSALGQLAAGIAHEIRNPLTSLKGFLQLMMQEETYKKEYMDVMMSEFNR
LELIISELLILAKPEVVKYENKQINLILQDVCTLLHTQAILKNITISTDFEEKLPVVHCI
EKDMKQVFINMVKNSIEAMDDPGSILVVSKFDPDTNQVVIQVIDEGKGMPKDRLTRISEP
FYTTKEKGTGLGLMVSHKIISNHKGSISYESEEGKGTTVEIRLPLS
NT seq 3561 nt NT seq  +upstreamnt  +downstreamnt
atgaagaacaactcgttttctacagttccatcgtctacagaaggaatagagaaacaggat
ttacacgttgtgggaattggcgcttctgccggagggttggaagctattgagcagtttttc
gctaatatgccttcaccaaatggaatggcgtttattattgtacaacacctttcctctaaa
tataaaagctttatgccagaacttttagcaaagaaaacaggaatgaatatcgaactgaca
caagacgggatgactttacaagaagacacaatttatttaaatcctccccatcattatgtg
accgttgttgatcatactcttcaccttcgtccttatgaagaaaatgatcaggtaaagtat
ccaattgacgccttttttcattctcttgctgctgcaaaaaaacatcgatgcacagccatt
attttatcgggaaaaggaaatgatggaacaggaggagcaaaaacgatacgagagtacgga
ggcactgtacttgtacaagatgaaagcacagcgaagtacagagatatgcccctaagcgct
attgatgcacaccttgctgattatatcctttctcctgctgatatgcctgaccttgtgcaa
acgcatgtcagccaaactgaatttacatataatgaagaaacactgcaatacatttattca
ttaataaagaaaaaaacaggcatcgacttttctatgtataaaaaaaatacggtgctgcga
cgactcgaaaaaagaatggctttactcgacccaccctctcaaacgatggaagagtaccgg
gactatttatgtaaagaagccgaagaaatcgtcgaactgcagcgagacctgctgattgga
gtgacgcaatttcttagagatagagaagccttctctattatcgaagaacaagtcatccct
caattagtagaaagaaagattcatagtcaagaagatgaaatccgcatctgggtagcaggt
tgttctaccggtcaagaagcatacacattagctattttgcttcatgactatttatcaaca
atcaaccgttatttcgatgtccgaatctttgctacagacatcgatcgtcatgcaattaaa
agagcgagccaaggcatttatgaagaagcggaagttcattccttctcagcatctcaaatt
aatgaatattttgagcaaacaaaacacggtggttatcaagtcaaaaaaacaatccgcaaa
atgattgtttttgccccgcataatataggaaaagactcgccttttgtaaacgttgattta
attagctgtagaaacatgatgatttatttccaagctgaactgcagcagcgcattctgtct
ctttttcatttttctttgacagaagaaggcgtactttttttaggtcctagtgaaacaaca
ggaaatttgtctgatttgttccgccctatcaacagtaaatggaaaatatttaagcgttcc
ggacagtccagccgacaaattacgggagcttttaatctttcgaaatccaacttgcatgaa
ggtgatttctctagcgtgccgctgccaagtcaactttataagcctcttccttcgcttaaa
ttagatgagatgtatcaatcaatgattgatcactttatgagcccttgtcttgtattaaat
gaatacaatgaagtaatattttgttcaaaagaagcgactcagcttattaacgttcctgta
ggcaaaattaattatacgattttcaaaatggttccagttcacgtctctttagccattgga
gcagctattaaacgtgtaaaagagcaaggtatgagcgtatgctgtcagcacattgagttt
gtcataaacaacgttcagcgccgttttaatattacaatatctgctcttccaacaaatcac
tctctttacttacttatgtttgatgaacagacagatggtgccattattgataaagaagag
cccttatttcttaatcaaacaagttctattagtgaacttgtagtagatttagagcaagag
cttcattacacgcagcagcatttgcaaacgacgattgaagagctggaaacagcaaatgaa
gagctaaagtcaacaaacgaagaactgattgcttctaacgaagagctgcagtctacaaat
gaagaattgcagtctgttaacgaagaattaattagtgttaacaaccagtacgagcgcaaa
attgaagaattaacggacttaaacaacgatattgataatttattaatcagtacaactatt
gctaccattttcttagacgagcagctgaatattaaattatttacgccggaaacgaaaacg
gtaatcaacgttctacatcaagatatcggaagacctttctttcatatttcgcataacttt
aggtatgaccatctaatcgaggatgcaatgcatgttttaagaacaaataacacccttcaa
aaagaaattcaaagctacgataaccaatggtacagcatgaaaatgatgccttatcgtacg
aatgagaatttaattaacggtgtagttattacgtttattaatattacagaaattaaacga
tccaatgaggaattggctattacatcatttgcagtagctcatagccctaccggcattttt
attaccgatcatcaaggtaaaattaagtacattaatcaaaaattcatggagcaaaagcat
gcgccgcaggaagtatttgggctacacctctatgacttatatactaaaaagctaggcgtt
aaaagattccctaaaatttggaacgaagtatatagaggagaaaaatggaacggagaaatt
tcctacgttcaagaagacggggaaaccgtttgggaacagttagccttaatgcctgttaaa
aatgatcaggatgaaatcatccattacattgggttaagtgaagacatttcacagcgcaaa
cagtcggaaatgatgctcaaaaattcagagatgctatcagcactcgggcaactggctgct
gggattgcccatgaaatacgaaaccctcttacatcattaaagggctttttacagcttatg
atgcaagaagaaacgtataaaaaagaatatatggatgtcatgatgtccgagtttaaccgc
ttagaactgattattagcgaactgctcattctagccaaacccgaagtcgtaaaatatgaa
aataagcagataaatttaattcttcaagacgtatgtacactactgcatacacaggccatt
cttaaaaacattactatttcaacggattttgaagaaaaattacctgttgttcattgtatt
gaaaaagatatgaaacaagtatttatcaacatggtgaaaaattctattgaagcgatggat
gaccccgggtctattctagtggtatctaaatttgatccagatacaaatcaagtagtcatc
caagtgatagatgaaggaaaaggcatgccgaaagatcgattaacacgaattagcgagcct
ttctatacaacaaaagaaaaaggaacaggattaggattgatggtgagtcacaaaatcatt
agtaatcataaaggaagcatttcgtatgaaagtgaagaaggaaaaggaacaacggtagaa
attcgattaccgctttcttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system