KEGG   Bacillus megaterium WSH-002: BMWSH_2981Help
Entry
BMWSH_2981        CDS       T01890                                 

Definition
Agmatine ureohydrolase (agmatinase)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
bmh  Bacillus megaterium WSH-002
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmh00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BMWSH_2981
Enzymes [BR:bmh01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     BMWSH_2981
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2797908..2798513)
Genome map
AA seq 201 aa AA seqDB search
MTLGELRAIAKKHGPVALLQFDAHSDTWDSYFEQKYNHGTVFRRAIEEGLIDVSRSIQIG
MRGGLYGIEDLEDAKNLGLALYTTNEYKKLGVERMLDIIHERVGEGPVFLSFDIDFLDPV
YAPGTGTPEVSGASIDDALQFVRGLTNIDFVGFDLVEVLPAYDHGQITAAAAANIVYEFI
TLIALRKKAKEEEALLVKARD
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgacccttggtgaacttcgtgcgattgcaaaaaaacacggaccggtagcacttttacag
tttgatgctcattctgatacgtgggatagctattttgaacaaaaatacaatcacggtacg
gtattcagacgagcaattgaagaagggttaatcgacgtatcgcgctcgattcaaatcggt
atgcgaggcggtctgtacggcattgaagatttagaagatgcaaagaacttaggtctagct
ctgtatacgacaaatgaatataaaaaactgggcgttgaaagaatgctagatattattcat
gagcgtgtaggagaaggacccgtatttttatcgtttgacattgactttttagatccagtt
tacgcaccgggaacaggaacacctgaagtctcaggtgcaagtattgacgatgcgcttcaa
ttcgttcgaggcttaacaaatattgactttgtcggttttgatttagtggaagtactgcca
gcttatgatcatggtcaaattacagcagcagcggccgctaatattgtctatgaatttatc
acgcttattgcgttaaggaaaaaagcaaaagaagaagaagcgctgttagtaaaagcacgc
gactga

DBGET integrated database retrieval system