KEGG   Bacillus megaterium WSH-002: BMWSH_3139Help
Entry
BMWSH_3139        CDS       T01890                                 

Gene name
yngB
Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase YngB
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bmh  Bacillus megaterium WSH-002
Pathway
bmh00040  Pentose and glucuronate interconversions
bmh00052  Galactose metabolism
bmh00500  Starch and sucrose metabolism
bmh00520  Amino sugar and nucleotide sugar metabolism
bmh01100  Metabolic pathways
bmh01130  Biosynthesis of antibiotics
Module
bmh_M00362  Nucleotide sugar biosynthesis, prokaryotes
bmh_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bmh00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BMWSH_3139 (yngB)
   00052 Galactose metabolism
    BMWSH_3139 (yngB)
   00500 Starch and sucrose metabolism
    BMWSH_3139 (yngB)
   00520 Amino sugar and nucleotide sugar metabolism
    BMWSH_3139 (yngB)
Enzymes [BR:bmh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BMWSH_3139 (yngB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2 Exo70
Motif
Other DBs
NCBI-ProteinID: AEN90021
UniProt: G2RR85
Position
complement(2941338..2942144)
Genome map
AA seq 268 aa AA seqDB search
MLPIVDKPAVQYIVEEAVKSGIESIIFITGRNKKSIEDHFDKSIELEQMLEEKHKYEMLK
EVQTISSMASIHYIRQKEPLGLGHAILCAEQFIGDEPFAVLLGDDIMTSEEPALKQMIQA
YETTNQSVIGVQKVDVEEVSKYGIIQPKNKSGSLHEVNDLVEKPSIEQAPSTIAVMGRYI
LNPSIFSYLKTIERGVGNELQLTDALRVVCEKERLFALELEGKRFDIGDKVGYMKAMVEV
ALKRKDLRQTFLSYLEGIVEKERANNFS
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgctgccaattgttgataagcctgctgtacaatatattgtagaagaagctgtgaaatca
ggtattgaaagtattatttttattacaggccgaaataaaaaatcaattgaagaccatttt
gataaatcaattgaattagagcaaatgcttgaagaaaagcacaagtacgaaatgttaaaa
gaagtacaaacgatttcatcaatggccagcattcactatattcgtcaaaaagagccgtta
ggacttggtcatgctattctttgcgccgagcagtttattggagatgagccgtttgccgtt
cttcttggagacgatattatgacttctgaagaacctgcccttaaacagatgatccaagcg
tatgaaacgactaatcaatcagttatcggagttcaaaaagtggatgttgaagaggtatcg
aaatacggcatcattcagccaaaaaataaatccggcagccttcatgaagtgaatgacttg
gttgaaaaaccatcgatagaacaagctccgtcaactattgccgttatgggccgctacatt
ttaaacccttctattttttcttatctaaaaacgattgaaagaggggtaggaaatgaatta
caattaacagatgcactgcgtgtagtatgtgaaaaagagaggctgtttgctcttgaactg
gaagggaaacgctttgacattggagataaggtaggctatatgaaagcaatggtagaagtg
gcgttaaagcgtaaagatttacgtcaaacgtttttatcgtatttggaaggaattgtagaa
aaagaacgagcaaacaacttcagctaa

DBGET integrated database retrieval system