KEGG   Bacillus megaterium WSH-002: BMWSH_3355Help
Entry
BMWSH_3355        CDS       T01890                                 

Gene name
lacZ
Definition
beta-galactosidase I
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
bmh  Bacillus megaterium WSH-002
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:bmh00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    BMWSH_3355 (lacZ)
Enzymes [BR:bmh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     BMWSH_3355 (lacZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3134901..3136850)
Genome map
AA seq 649 aa AA seqDB search
MYIGVDYYPEHWPENMIEEDIQGIKELGSNMVRIGEFAWHLMEPKEGEYDFSFFDSVINK
LKKQNIDVMFGTPTATFPAWLAKKHPSILSKDESGAVRAFGGRRQYCFNSPLYRKYSAQI
TEQLVKHYCSEEAIVAWQVDNEFGHEGSDMCYCEQCHKEFQQFLERKYKDINELNEKYGT
IFWGQTYNEFTEVPMPVKTITTHSPSLKLDWARFRSFSLNRYAHEQTAIVKRYKGDHQLL
TTNVSGGFFDKWFDHEENLEVMDFVSYDNYPVWGGQTEPITPAHIALGHDFNRGLLHKNF
WIVEELMGAQGHDVIGYLPRPNQAKMWSYQAFAHGCTDMLYFRWRGMTRGAEQYCYGIVG
HDNHYGRRYKEVQSLFSEIVKYEHVLESDIKSDVAVLYDYENIWSWRFQQQSEGFDFTQE
LLRGYTPFYKLNTPIDVIPATRDFSSYKVLVVPALQIIDEELGKRFTEFTESGGVIVFTF
RTGIKDKQNNIHFKQTLPGYVKEITGIEIHEVEALSSTQKAAIKGVGPYEGEQSSASVWR
DIITPVTAEVLYEYDDPFYNQAAVTKNQFGRGTVYYVGCGIEGQTFEKIALDIVTEQHIE
HTESEEGIEVYPRKLGEKSYYFLMNHTPEVKVFKGNVLQPYESRIIENM
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atgtacatcggtgtcgattattaccctgaacattggccagagaatatgatagaagaagat
atccaaggcattaaagagctaggatcaaacatggtgagaataggagagttcgcttggcat
cttatggagcctaaagaaggtgaatatgatttttctttttttgatagcgttatcaataag
ctcaaaaaacagaatattgatgttatgtttggtacgcctactgccacttttccggcttgg
cttgcgaagaagcatccttctattttatccaaagatgaaagcggggcggtcagagccttt
ggaggaagacgtcaatattgttttaattcgcctctttaccggaagtatagtgctcagatt
acagaacaacttgtaaagcattactgctcagaagaagcaatcgtagcatggcaagttgac
aatgaatttggccatgaaggcagtgacatgtgttactgcgaacaatgtcataaagagttt
cagcagtttttagaaagaaaatacaaagacatcaatgagttaaatgagaagtatggcact
attttctggggacaaacatataacgagtttactgaagtgcctatgcctgtaaaaacaatt
acgacacacagtccttcgttaaagcttgattgggcgcgctttcgctctttttcgttaaac
agatatgctcatgaacaaacagcaattgtgaagagatataaaggtgatcaccagctgttg
acaacgaacgtctcaggaggtttttttgataaatggtttgaccatgaagagaatctagaa
gtcatggactttgtatcctatgacaattatccggtatggggcggtcaaacagagccgatt
acccctgctcatattgcactgggacatgattttaatagaggtctgctacataaaaacttc
tggattgtagaggaattaatgggtgctcaaggtcatgatgtcatcggttatctaccgagg
cctaatcaggcaaaaatgtggtcttatcaagcgtttgctcatggatgcacggacatgctg
tatttccgttggcgcggaatgacaagaggagctgagcaatactgctacggaattgtaggt
cacgataatcattatggaagacgctacaaagaagttcagtcgttatttagtgaaatcgtt
aagtacgaacatgtacttgaatctgacattaagtcggatgttgccgttttatatgactat
gaaaatatatggtcatggcgctttcagcagcaaagtgaagggtttgactttacgcaagag
cttcttagagggtatacaccgttttataagttgaatacacctattgatgttattcctgct
acaagagatttttcaagctataaagtactggttgttccagctttgcaaatcattgatgaa
gaactaggtaagagatttactgaatttactgaaagcggaggcgttatcgtttttacgttt
agaaccggcattaaagacaaacaaaataatattcattttaaacagacgctcccgggatat
gtaaaagaaataacaggaattgaaattcatgaagttgaagcactgtcttctactcaaaaa
gcagctattaaaggagtaggaccgtatgaaggagaacagtcaagtgcgtccgtgtggaga
gatattatcacgcctgtaacagctgaagtgctgtatgagtatgatgatccattctataat
caagcggcggtaacaaaaaatcagtttggtcgtggaaccgtttattatgtaggctgtgga
attgaagggcaaacgtttgaaaaaattgcgcttgatattgtaacagagcagcatattgag
catacggaaagtgaagaggggattgaagtatatcctcgcaagcttggagagaaaagttat
tacttccttatgaaccatacgccagaagtaaaagtatttaaaggtaatgttctgcagcct
tatgaaagtcgtattatagaaaacatgtag

DBGET integrated database retrieval system