KEGG   Bacillus megaterium WSH-002: BMWSH_3355Help
Entry
BMWSH_3355        CDS       T01890                                 

Gene name
lacZ
Definition
beta-galactosidase I
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
bmh  Bacillus megaterium WSH-002
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bmh00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3134901..3136850)
Genome map
AA seq 649 aa AA seqDB search
MYIGVDYYPEHWPENMIEEDIQGIKELGSNMVRIGEFAWHLMEPKEGEYDFSFFDSVINK
LKKQNIDVMFGTPTATFPAWLAKKHPSILSKDESGAVRAFGGRRQYCFNSPLYRKYSAQI
TEQLVKHYCSEEAIVAWQVDNEFGHEGSDMCYCEQCHKEFQQFLERKYKDINELNEKYGT
IFWGQTYNEFTEVPMPVKTITTHSPSLKLDWARFRSFSLNRYAHEQTAIVKRYKGDHQLL
TTNVSGGFFDKWFDHEENLEVMDFVSYDNYPVWGGQTEPITPAHIALGHDFNRGLLHKNF
WIVEELMGAQGHDVIGYLPRPNQAKMWSYQAFAHGCTDMLYFRWRGMTRGAEQYCYGIVG
HDNHYGRRYKEVQSLFSEIVKYEHVLESDIKSDVAVLYDYENIWSWRFQQQSEGFDFTQE
LLRGYTPFYKLNTPIDVIPATRDFSSYKVLVVPALQIIDEELGKRFTEFTESGGVIVFTF
RTGIKDKQNNIHFKQTLPGYVKEITGIEIHEVEALSSTQKAAIKGVGPYEGEQSSASVWR
DIITPVTAEVLYEYDDPFYNQAAVTKNQFGRGTVYYVGCGIEGQTFEKIALDIVTEQHIE
HTESEEGIEVYPRKLGEKSYYFLMNHTPEVKVFKGNVLQPYESRIIENM
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atgtacatcggtgtcgattattaccctgaacattggccagagaatatgatagaagaagat
atccaaggcattaaagagctaggatcaaacatggtgagaataggagagttcgcttggcat
cttatggagcctaaagaaggtgaatatgatttttctttttttgatagcgttatcaataag
ctcaaaaaacagaatattgatgttatgtttggtacgcctactgccacttttccggcttgg
cttgcgaagaagcatccttctattttatccaaagatgaaagcggggcggtcagagccttt
ggaggaagacgtcaatattgttttaattcgcctctttaccggaagtatagtgctcagatt
acagaacaacttgtaaagcattactgctcagaagaagcaatcgtagcatggcaagttgac
aatgaatttggccatgaaggcagtgacatgtgttactgcgaacaatgtcataaagagttt
cagcagtttttagaaagaaaatacaaagacatcaatgagttaaatgagaagtatggcact
attttctggggacaaacatataacgagtttactgaagtgcctatgcctgtaaaaacaatt
acgacacacagtccttcgttaaagcttgattgggcgcgctttcgctctttttcgttaaac
agatatgctcatgaacaaacagcaattgtgaagagatataaaggtgatcaccagctgttg
acaacgaacgtctcaggaggtttttttgataaatggtttgaccatgaagagaatctagaa
gtcatggactttgtatcctatgacaattatccggtatggggcggtcaaacagagccgatt
acccctgctcatattgcactgggacatgattttaatagaggtctgctacataaaaacttc
tggattgtagaggaattaatgggtgctcaaggtcatgatgtcatcggttatctaccgagg
cctaatcaggcaaaaatgtggtcttatcaagcgtttgctcatggatgcacggacatgctg
tatttccgttggcgcggaatgacaagaggagctgagcaatactgctacggaattgtaggt
cacgataatcattatggaagacgctacaaagaagttcagtcgttatttagtgaaatcgtt
aagtacgaacatgtacttgaatctgacattaagtcggatgttgccgttttatatgactat
gaaaatatatggtcatggcgctttcagcagcaaagtgaagggtttgactttacgcaagag
cttcttagagggtatacaccgttttataagttgaatacacctattgatgttattcctgct
acaagagatttttcaagctataaagtactggttgttccagctttgcaaatcattgatgaa
gaactaggtaagagatttactgaatttactgaaagcggaggcgttatcgtttttacgttt
agaaccggcattaaagacaaacaaaataatattcattttaaacagacgctcccgggatat
gtaaaagaaataacaggaattgaaattcatgaagttgaagcactgtcttctactcaaaaa
gcagctattaaaggagtaggaccgtatgaaggagaacagtcaagtgcgtccgtgtggaga
gatattatcacgcctgtaacagctgaagtgctgtatgagtatgatgatccattctataat
caagcggcggtaacaaaaaatcagtttggtcgtggaaccgtttattatgtaggctgtgga
attgaagggcaaacgtttgaaaaaattgcgcttgatattgtaacagagcagcatattgag
catacggaaagtgaagaggggattgaagtatatcctcgcaagcttggagagaaaagttat
tacttccttatgaaccatacgccagaagtaaaagtatttaaaggtaatgttctgcagcct
tatgaaagtcgtattatagaaaacatgtag

DBGET integrated database retrieval system