KEGG   Bacillus megaterium WSH-002: BMWSH_3376Help
Entry
BMWSH_3376        CDS       T01890                                 

Gene name
acoC
Definition
(GenBank) Acetoin dehydrogenase, E2 component, dihydrolipoyllysine-residue acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bmh  Bacillus megaterium WSH-002
Pathway
bmh00010  Glycolysis / Gluconeogenesis
bmh00020  Citrate cycle (TCA cycle)
bmh00620  Pyruvate metabolism
bmh01100  Metabolic pathways
bmh01110  Biosynthesis of secondary metabolites
bmh01120  Microbial metabolism in diverse environments
bmh01130  Biosynthesis of antibiotics
bmh01200  Carbon metabolism
Module
bmh_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bmh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BMWSH_3376 (acoC)
   00020 Citrate cycle (TCA cycle)
    BMWSH_3376 (acoC)
   00620 Pyruvate metabolism
    BMWSH_3376 (acoC)
Enzymes [BR:bmh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BMWSH_3376 (acoC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3 RnfC_N GCV_H DUF2118 PYNP_C AATase
Motif
Other DBs
NCBI-ProteinID: AEN90258
UniProt: G2RWV5
Position
complement(3164024..3165253)
Genome map
AA seq 409 aa AA seqDB search
MAAEVVMPKLGMAMKEGTVSTWNKKVGDSVSKGDMIASINSEKIEMEIEAPQDGVILDIL
VQEDVGVPPGTIICYVGNPNEQLTEQNRSANELQAPKNEVAATISLEEPPANAASSKKSK
EAVRISPIARKIAESENIDIETIKGTGPKGRITKADVEKVLAERAAEASHPPAERDNPAI
NKETLPVAGMRKVIAGRMHNSLLNSAQLTINMRADVTDLLSLQQEIKEVTQQRHKVKISL
TDFIARAVVLSLQEHKQMNSAYIDNEIHLYNHVHLGMAVALENGLVVPVMQHAEKMSLVE
LAAEIKTRAGDARQGQLSTDRMQGSTFTITNLGAYGVEYFTPVLNPPETGILGVGATEDV
PMYQGDELQRRSLLPLSLTFDHRVLDGAPAANFLGTIKQYLEQPILLLL
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atggctgcagaggttgtaatgccaaaactaggtatggcaatgaaagaaggaaccgtttcg
acatggaataaaaaagttggagactccgtttcaaaaggagatatgattgcaagtattaat
tctgaaaaaatcgaaatggaaattgaagctccgcaggacggtgtgattcttgatatcctt
gtacaagaagatgtaggtgtgcctcctggaacgattatctgttatgttggaaatccaaac
gagcagcttactgagcagaaccgttcagcaaatgagcttcaggctcccaaaaacgaggta
gcggctactatttctttagaagagccaccagcaaacgcagcttcgtcaaagaagagcaaa
gaagctgtgcgcatttcaccaattgcacggaaaatagccgaatctgaaaacattgatatt
gagacgattaaaggcacgggacctaaaggaagaatcacaaaagcggatgtagagaaagtg
ctggcggaaagagctgcagaagcgagtcacccaccggcagaaagagataaccccgctata
aacaaagaaacgcttccagtagcgggcatgaggaaagtcattgcaggccgaatgcataat
agcttattaaacagtgctcaattaacgattaatatgagagctgacgtgacggacttgctg
tctcttcaacaagaaattaaagaagtgacccagcaacgccataaggtgaaaatctctcta
accgattttattgctcgggctgttgttctttcacttcaagaacacaagcaaatgaacagt
gcctatatcgataacgaaattcatctctataaccatgttcatcttggaatggccgtggct
ttagaaaatggattagttgttcctgttatgcagcatgctgaaaagatgtcgttagttgaa
ttagctgcagagattaaaacacgagcaggggatgctcggcaaggtcagctgagcactgat
agaatgcaaggttctacattcactattactaatctgggtgcttacggagtagagtatttt
acacctgtattaaatccgcctgaaacaggaattcttggtgttggagctactgaagatgta
ccaatgtatcaaggagacgaattacaaagaagaagcttgctgcctttaagcctgacgttt
gatcatcgggtactggacggggcacctgcagctaatttccttggaactattaaacaatac
ttagagcaacctattttactactcttatag

DBGET integrated database retrieval system