KEGG   Bacillus megaterium WSH-002: BMWSH_3523Help
Entry
BMWSH_3523        CDS       T01890                                 

Gene name
pbgA
Definition
glycosyl hydrolase family protein
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
bmh  Bacillus megaterium WSH-002
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:bmh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BMWSH_3523 (pbgA)
Enzymes [BR:bmh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     BMWSH_3523 (pbgA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3298731..3300137)
Genome map
AA seq 468 aa AA seqDB search
MKMPKDFLFGAASASYQVEGAWNKDGKGVSNWDVFSKIPGKTFEGTNGDVAIDHYHRYKE
DIALMAEMGLESYRFSIAWTRILPNGTGEVNQKGLEFYNNVIDECLKHGIVPFVTLYHWD
LPQTLEEEGGWLNPKTADAFVTFADVCFRAFGDRVRNWITFNETVIFCSLGYLTGAHPPG
IEGDAKAYFQATHNVFVAHARAVELFKQSSYEGEIGITHVFNPAFSIDEDEENKFAERHA
NAYSTHWYYDPILKGAYPQYVIKELEAKGLLPQMTEEELDLLHRTAPMNDFIGLNYYCPQ
RVMKNDSALVLSGGRENSTGKPGNPSFDGVYKTVMMEEKVYTKWGWEIAPDAFLEGMRML
KERYGDIKMYITENGLGDEDPIVGEEIHDQPRIDYIENHLSAVKKAVMEGINVSGYFAWS
VIDLLSWLNGYKKQYGFIYVDHKNNLARKRKQSFFWYKDIIATRAEEL
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaatgccaaaagatttcttgttcggcgcagcttcagcttcttatcaagtagaaggg
gcatggaacaaggacggtaaaggggtttcgaactgggacgtcttctcaaagattcccggt
aaaacatttgaaggaacaaacggtgatgtggccattgatcattatcaccgatataaagaa
gacatcgcacttatggcagagatgggattggaatcgtatcggttttccattgcctggaca
cgtattcttcccaacggtacaggtgaagtaaatcaaaaaggattggaattctataataat
gtcattgatgaatgtttaaaacacggaattgttccgttcgtcacattgtatcactgggac
cttcctcaaacgcttgaagaagaaggcggctggctaaatcctaaaacagccgatgcattt
gtcacgtttgctgatgtttgttttagagcattcggcgatcgagtacggaattggattacc
tttaacgaaacggttatcttttgttcgttaggctatttaaccggtgctcacccaccagga
attgaaggggatgcgaaagcatactttcaggcgacacataatgtgtttgtggctcatgcc
cgtgcggttgaacttttcaaacagtcaagctatgagggggaaattggcattactcatgtt
tttaacccggcgtttagcattgatgaggacgaagagaacaaatttgcagaaagacatgcg
aatgcatattcgacacattggtattatgatccaattttgaaaggagcttacccacaatat
gtaataaaagagctcgaagctaaagggctactcccgcaaatgacagaagaagaactggat
ttgcttcatagaacggcacctatgaatgatttcatcggattaaactattactgcccacag
cgcgtaatgaaaaacgattcagccctcgtattgtctggtggacgtgaaaactcaacaggt
aaacctggaaacccttcatttgacggtgtatacaaaacagtcatgatggaagaaaaagta
tataccaaatggggatgggaaattgctcctgatgcttttctagaagggatgcgtatgctt
aaagaacgctacggggacatcaaaatgtatatcacggaaaacggtttaggagatgaagat
cctatcgttggtgaagagattcatgatcaacctcgaatcgactatattgaaaatcattta
agcgctgtcaaaaaagctgtcatggaaggaattaacgtctcaggatactttgcatggtct
gtcattgatttgcttagctggttaaatggttataaaaaacaatacggattcatttatgtc
gatcacaaaaataatcttgcaagaaaacgaaagcagtcattcttttggtacaaggatatt
atcgctacacgcgcagaagaactttaa

DBGET integrated database retrieval system