KEGG   Bacillus megaterium WSH-002: BMWSH_3719Help
Entry
BMWSH_3719        CDS       T01890                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bmh  Bacillus megaterium WSH-002
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bmh00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BMWSH_3719
   00052 Galactose metabolism
    BMWSH_3719
   00500 Starch and sucrose metabolism
    BMWSH_3719
   00520 Amino sugar and nucleotide sugar metabolism
    BMWSH_3719
Enzymes [BR:bmh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BMWSH_3719
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3483501..3484409)
Genome map
AA seq 302 aa AA seqDB search
MQSIKKAVIPAAGLGTRFLPVTKSIPKEMLPIVNKPVIQFIVEEALKSGIEDILIVTGNG
KQAIENHFDHNIQLEHLLHQKGKTELLEEMEHISELANIHYVRQKEMKGLGHAIGCARQF
IGNEPFAVLLGDDLTDPDHPCLKQLIDQYNRTGSSVIGVQRVEEKSVHRYGIIDPKANKS
RLYEVNGFVEKPSVEEAPSNLGIIGRYVFTPDIFDYLETQEAGKGGEIQLTDAIQRMNID
RSIYAYEFEGERYDAGEKLDFIFTTLAFALKDEELKAPLLTKFKELINKEEQKEKIAVQI
GK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgcagtctatcaaaaaagcagttataccagcagcagggttaggtactcgttttttacct
gttacaaaatctatcccaaaagaaatgcttccaattgtaaataagcccgtcattcaattt
attgtagaagaagccttaaaatcaggaatcgaagatattttaattgttacaggaaacggg
aaacaagcaattgaaaatcattttgatcataatattcaactagaacacttgcttcatcaa
aaaggaaagaccgaactattagaggaaatggagcatatctctgaactagcgaatattcat
tacgttcgtcaaaaagaaatgaagggccttggccatgcgattggctgtgctcgacagttt
attggaaacgaaccgtttgcagttttacttggagatgacttaacagacccagaccatcct
tgtttaaaacagctgattgaccagtataaccgaacgggatcgtcggttatcggcgtacag
cgcgtagaggaaaaatccgttcaccgttatgggattatagatccaaaagcaaataaaagc
cgattatacgaagtgaatggttttgtagaaaaaccatcagtcgaagaagctccgtctaat
ttggggattattggacgctatgtatttacacctgacatttttgattaccttgaaacgcag
gaagctggaaaaggcggggaaattcagctaacggatgctattcagcgtatgaatatagac
cgttctatttatgcttacgaattcgaaggcgaacgttatgatgcaggggaaaaattagat
tttatttttacgactcttgcttttgcgttaaaagatgaagaattaaaagcacctctttta
actaaattcaaagagctgatcaacaaggaagaacaaaaagaaaaaattgctgtacaaatt
ggaaaataa

DBGET integrated database retrieval system