KEGG   Bacillus megaterium WSH-002: BMWSH_4018Help
Entry
BMWSH_4018        CDS       T01890                                 

Gene name
phoB
Definition
alkaline phosphatase III
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
bmh  Bacillus megaterium WSH-002
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bmh00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:bmh00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:bmh02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3762475..3764130)
Genome map
AA seq 551 aa AA seqDB search
MKKKLAGITLAGAVALASFGVGNSLIQTEAKVEHKSAKKPKNVIMMVMDGTSSNATTLAR
WYKGKPLHMDQLMAGGVRAYSAESAITDSAPAATALATGNKSNSGYVGVLPSVVNTPGVK
SVEKEDQFRPVANVLEGAKLSGRATGIVATSEIQHATPAGFSAHNYNRDDFQTLAEQQVY
QNMDVVLGGGKQSLLPGAEEKSRKDGENLVNVLNKRGYDFVENKKELEQSRSKKIWGNFA
DRDLAYDMDRPQTKAEQPKLSEMTNKAITTLSKDKDGFFLFVEGSKTDWAAHANDPVGMI
SDVLAFDEAVGKAVEFAKKDGNTMVIAIADHGNSGLSIGNANTTKGYDTTPVSAYIDPLK
KAKMTLEGATSKLKEDLSNKEEVAALYGLSNLTSEEKAQLTKARDKKEISATLPKLLANR
ANLGFTTGGHTGEDVFLYSYGVNRPMGHFDNTDIAKHMAKSMNINLNELTNELFIEANKA
FKGSNVAIDTKDKNNPVLVVTNNKRTVRFPVNKNIAIVNGKEMQMDSVIVQDKNGRFFVP
KQAQQIVKNAK
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaaaattagcaggtattacactggcaggagcggtagcattggcctcgtttggt
gtaggaaactcacttattcaaacggaagcaaaagtggagcataagtcagctaagaaacct
aaaaatgtcattatgatggtaatggacgggacgagttcaaatgctactacactcgcaaga
tggtacaaaggaaaaccgttacacatggatcagctaatggccgggggagtacgggcgtat
tcggcagaatctgctattaccgattccgctccggcagctactgctttagcaacaggaaat
aaatcaaattcaggctatgtaggcgtgttgccttcggtagtaaatacgcctggagttaaa
tctgtagagaaagaggatcagtttcgtccggtagcaaacgttctagaaggagcaaagctt
tcagggcgcgcgacaggaatcgtggctacttctgaaatccagcatgccacaccagctggg
ttttcagctcataactataaccgtgatgacttccaaacgttagctgagcagcaagtatat
caaaacatggatgtagtgcttggaggaggtaagcagtctcttcttccaggagcagaagaa
aaaagccggaaagacggtgaaaacttagtcaatgtattgaataaaagaggatatgacttt
gtagaaaacaaaaaagaattagagcagtcgcgctctaaaaaaatctgggggaacttcgct
gaccgagacttggcgtatgatatggaccgcccacagacaaaagcagaacagccaaagttg
tccgagatgacaaataaagcaataacgacgttgtcaaaagataaagatggttttttctta
tttgttgaagggagcaaaacggattgggcagctcatgccaatgatccagtaggaatgatt
agcgatgtattagcgtttgatgaagcagtgggcaaagcagtagagttcgctaaaaaagat
ggaaatacgatggttattgcgattgccgatcatgggaacagcggtctttcaatcggtaat
gcaaatacaacaaaaggatacgataccacacctgtttctgcttatattgacccattaaaa
aaagcaaaaatgacgttagaaggcgctacgtctaaattaaaagaagatttatcaaataaa
gaagaagtagctgctttgtatggtttatcaaatctaacttcagaggaaaaagcgcagctg
actaaagcaagagataaaaaagaaatcagtgctacactaccgaagctattagccaaccga
gcaaaccttggattcacaacgggcggtcatacgggtgaggatgtatttttatactcgtac
ggcgtaaatcgaccaatggggcactttgataatacggatattgccaaacatatggctaag
tcaatgaacattaacttaaacgaattaacaaacgaattgtttattgaagcaaataaagcg
tttaaaggctcaaatgtagcgattgacacaaaagacaaaaacaatcctgtgctggtagta
acaaacaataagcgaacggtacgttttccagtaaacaaaaatattgcgattgtaaatggg
aaagaaatgcagatggacagcgtaattgtacaggataaaaatggtcgcttctttgtaccg
aaacaggcacagcaaattgtaaaaaatgcaaaataa

DBGET integrated database retrieval system