KEGG   Bacillus megaterium WSH-002: BMWSH_4149Help
Entry
BMWSH_4149        CDS       T01890                                 

Gene name
folE
Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
bmh  Bacillus megaterium WSH-002
Pathway
bmh00790  Folate biosynthesis
bmh01100  Metabolic pathways
Module
bmh_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bmh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BMWSH_4149 (folE)
Enzymes [BR:bmh01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     BMWSH_4149 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-ProteinID: AEN91028
UniProt: G2RPU9
Position
complement(3895363..3896007)
Genome map
AA seq 214 aa AA seqDB search
MALSTQNLIAQKFLETVGTDSTEIDKKIDQADTFMNAVKELIDLCGDNPERDGLEETPYR
VLKAFLEYTEGYREDPKAHLEKTFDVNHNELVLIRDIEFHSMCEHHFAPFFGVAHVGYIP
DKKITGLSKIARTVEGYAKRFQVQERLTNEIADAIEEVLEPKGVMVIIEAKHMCMCGRGI
KKSSASTATSSVRGTFMEKPEVRGEFLSLLQRQM
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atggcacttagtacacaaaatttaattgctcaaaaatttttagaaacagtaggaacagac
tcaactgaaatagataaaaaaatagatcaagctgacacatttatgaacgcggtgaaagaa
ctgattgatttatgcggagacaatccggaaagagacggtcttgaagagacgccgtaccgc
gtgttaaaggcatttttagaatacacggaaggctaccgagaagatccgaaagctcattta
gaaaaaacctttgacgtgaatcacaatgaattggtgctcatacgagatattgaatttcac
tcaatgtgtgaacatcactttgcgccgttctttggcgttgctcacgtggggtatataccg
gataaaaaaattacaggtctatctaaaatcgctcgtacggtagaaggatatgcaaagaga
tttcaggttcaagaacgtctaaccaatgagattgcagatgcaatcgaagaagtgttagag
ccgaaaggagttatggtgattattgaagcgaagcatatgtgcatgtgcggaagaggaatt
aaaaaatcttcagcttctacagccacttcatccgttcgaggaacatttatggaaaaacca
gaagttcgaggagaatttttatctcttttacagcgacaaatgtaa

DBGET integrated database retrieval system