KEGG   Bacillus megaterium WSH-002: BMWSH_4377Help
Entry
BMWSH_4377        CDS       T01890                                 

Gene name
speB
Definition
Agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
bmh  Bacillus megaterium WSH-002
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:bmh00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4129414..4130370)
Genome map
AA seq 318 aa AA seqDB search
MKYPLSPDVKPEFCTTGSFMRLPAERGNAKVGLVGMPFDTAASFRVGARFAPQAIRQASM
TLFPYHPVHDVYPFDDTNAIDIGDVPVIPHNIHRSYELMEEAVGALMDRGIVPIGIGGDH
SVTLASLRAAAKRYGPVAMIHFDSHTDTWDTYYDEKYWHGSPFIRAYEEGLVDPKKVFQI
GIRGTLNHPGDVQESKDLGYHVVTAGELERQGFSMILEQMKTAIGDTPCFLTFDIDFVDP
SCAPGTGTLEVGGFSSRETLQMIRSLTGFNYVGFDLVEVLPSYDPTQITSLLAATIIHDF
ASLVAVKTKRKSLDTTIE
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatccattgtccccagatgtcaaaccagaattttgtacaacaggctcatttatg
aggcttccagcggaaagaggaaatgcaaaagtagggctagtagggatgccgtttgatacg
gcggcatctttcagagtaggtgcgcgttttgcacctcaagccattcggcaagcttccatg
acgctgtttccttatcacccggtacacgacgtatacccatttgatgatacaaatgccatt
gatattggtgatgtgccggttattccgcataatattcacagaagctatgaattgatggaa
gaagcggtaggagctcttatggatagaggaatcgttccaattggaattggaggagatcat
tccgttactttagcaagccttcgtgctgctgctaaaagatatggcccagtggctatgatt
cattttgattctcatacagatacgtgggatacgtattatgatgaaaaatattggcacgga
tctccttttatacgcgcatatgaagaagggctagtagatccgaagaaagtttttcaaatt
ggtattcgcgggacattaaatcatccgggagatgttcaagaaagcaaagacctcggttac
catgtagtaacggcaggagagcttgaacgtcaggggttttcaatgattttggagcaaatg
aagacagcgattggagatacgccgtgctttttaacatttgatattgattttgttgatcct
tcttgtgcaccaggcacgggaacgcttgaagtaggcggattcagcagcagagaaacgctg
caaatgatccgttctctaacgggatttaactatgttggatttgacctagtagaagtgctg
ccttcttatgatccaactcagataacctctttgcttgcagctacaatcattcatgatttt
gctagtttagttgcagtgaaaacgaaaagaaagtcattggatacgacgattgaataa

DBGET integrated database retrieval system