KEGG   Bacillus megaterium WSH-002: BMWSH_4604Help
Entry
BMWSH_4604        CDS       T01890                                 

Gene name
asnO1
Definition
asparagine synthetase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
bmh  Bacillus megaterium WSH-002
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:bmh00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4360689..4362536)
Genome map
AA seq 615 aa AA seqDB search
MCGITGWVDLKRSLLNETATITKMADTLSKRGPDDTNVWTQQHVAFGHKRLVVVDPQGGR
QPMTREKNEQLYTLCYNGELYNTEDIRKELIKRGYQFQGHSDTEVLLTSYIEWKEACVDH
FNGIFAFSIWDEANEKLFIARDRMGVKPLFYRSYEGGIQFASELKAILAHPEVKAEVGLD
GLAEVFGLGPSRSPGHGVFKEINELRPAHALTLTRNGLKIWRYWNVKSEQHTDDLGETTE
KVKFLVQDAIVRQLVSDVPVCTFLSGGVDSSAITAIAANAFKESGKGSLHTYSIDYEDND
KFFKANEFQPNSDGTYIKLMSDTFQTNHHRCIISTEDLVQHLTEAVEVRDLPGMADVDSS
LLWFCREIKKDFVVSLSGECADEIFGGYPWFHRKHDLSSDTFPWMRSLDARIDLLQSSWR
KKLQLEDYVRARYEETLKEVPELEGESLEDAQRRKLFYLNQVWFMTTLLDRKDRMSMGAS
LEVRVPFADHRLVEYAWNIPWEMKMTGNKEKGILRKALEGILPHDVLYRKKSPYPKTHNP
AYTKAVTVWLQSLLQDKQSPLHEFFDKQQLKHIIDTGGEGFKAPWFGQLMTGPQLLAHLA
QIHVWFTHNNIQVVE
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggtataacgggttgggtcgacttaaagcgatcgcttttaaatgaaacagcaaca
ataacaaaaatggctgatactttatcgaaaagaggtcctgatgacaccaacgtatggaca
cagcagcatgttgcctttggacacaaacgcttagtcgtagtagatcctcaaggcggaaga
cagccgatgacgagagaaaaaaacgaacagctctacacgctttgctataatggggagctt
tacaacacagaagatattcggaaagaattaataaaaaggggctatcaatttcaagggcat
tccgatacggaagtacttctaacatcttatatagaatggaaagaagcgtgcgtagatcat
tttaacggtatctttgcgttttcaatctgggatgaagccaatgaaaagttatttatagca
cgtgacagaatgggagtgaagcctctattctatcgatcttatgaaggcggaattcaattt
gcatcagaattaaaggcgatattagctcatcctgaagtgaaagcggaagtaggattagat
ggattagcagaagtatttggcttaggaccttctcgttctcccggccacggcgtatttaaa
gaaataaatgaattgcgtccggctcacgcgctcacgcttacgcgtaacgggttgaagatt
tggcgatactggaacgtaaaaagtgagcagcatacagatgatctaggtgaaacgacagaa
aaagttaaatttttagtgcaagacgcgattgtaagacagctagtttccgatgttccggtt
tgtacatttttatccggtggagtagactcaagcgccattacggcaatcgctgcaaatgcg
ttcaaagaaagcggcaagggctctcttcatacgtattctatcgattatgaagacaatgat
aaattttttaaagcaaatgagtttcagcccaattctgatggaacttatatcaagctcatg
tcggatacgtttcaaacaaatcatcaccgctgcattatttcaacggaggaccttgtgcag
catttaacagaggctgtagaggtgagagaccttcctggaatggctgatgtagattcatcg
ctgctttggttttgccgtgaaatcaaaaaggactttgtcgtgagcttatcaggagaatgt
gcagatgaaatttttggaggatatccgtggtttcaccgaaaacacgatttgtcttcggat
acctttccgtggatgcgttcattagatgctcgaattgatttgctgcaaagttcatggaga
aagaaattacagttagaagattatgtgcgtgcaagatatgaagaaacattaaaggaagtg
cctgaattagaaggtgaatcgttagaagatgcgcagcggagaaagctgttttatttaaat
caggtttggtttatgacaactttattagatcgtaaagatcgcatgagcatgggagcgagc
ttagaagtacgcgtaccttttgcagatcatcgtcttgtggaatatgcatggaacattccg
tgggagatgaaaatgacgggcaataaagagaaaggtattttacgtaaagcccttgaaggg
attttgcctcatgacgttctttatcgcaagaaaagcccgtaccctaaaacgcataatcct
gcttatacaaaggctgtaactgtatggcttcaatcccttttacaagataaacagtcacct
cttcatgaattttttgataagcagcagttaaagcatattattgatacaggcggagaaggg
tttaaagcaccgtggtttggtcaattaatgacagggcctcagctgctagctcatctagct
caaattcacgtctggtttactcacaataatattcaggttgttgaatga

DBGET integrated database retrieval system