KEGG   Bacillus megaterium WSH-002: BMWSH_4623Help
Entry
BMWSH_4623        CDS       T01890                                 

Gene name
aceA
Definition
Isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
bmh  Bacillus megaterium WSH-002
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:bmh01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:bmh00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4384513..4385796)
Genome map
AA seq 427 aa AA seqDB search
MKDIRVKNLEENWKSDERWKGIERPYSAEKVIGLRGSIDIEHTLARRGAEKFWNLLKTEP
YVHALGALTGNQAVQQVKAGLKAIYLSGWQVAADANLSGNMYPDQSLYPANSVPHVVKRI
NQALQRADQIQHLEGEGDIDYFAPIVADAEAGFGGQLNVFELMKGMIESGASAVHFEDQL
SSEKKCGHLGGKVLLPTQTAVKNLIAARLAADVMGVPTLLIARTDADAADLITSDVDPVD
RQFITGERTAEGFYRTRAGIDQAIARGLAYAPYADLVWCETSEPNLEQAQKFADAIHEKF
PGKMLAYNCSPSFNWKKKLDKKTIEKFQREIAKMGYKFQFVTLAGFHALNHSMFELARGY
KTRGMAAYSELQEREFASEINGYTATRHQREVGTGYFDEVAQVVSGGTSSTTALKGSTEE
EQFQAHK
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgaaagacattcgtgtaaaaaaccttgaagagaactggaaaagcgatgagcgttggaaa
ggaattgaacgtccatattctgcagaaaaagtcattgggctaagagggtccattgatatt
gaacatacgcttgctagaagaggagccgaaaagttctggaacttattaaaaacagagcca
tacgttcatgcattaggagctttaacaggaaatcaagcagtacaacaggtaaaagcgggg
ttaaaagcaatttacttaagcggatggcaagtagctgcagatgcaaatctttcaggaaac
atgtatcctgatcaaagtttatacccggcaaacagcgtgccgcatgttgtgaaacgaatc
aatcaagcgctgcagcgtgccgatcaaattcagcatttagaaggagaaggggatatcgat
tactttgctccaattgtagcagatgcagaagcagggtttggaggacagttaaacgtattt
gaactaatgaaaggaatgattgagtcgggagcatctgccgtacactttgaagatcaatta
tcctctgagaaaaagtgtggccaccttggcggcaaggtattgctgccaactcagaccgct
gtgaaaaatttgattgctgctcgtttagctgctgatgtaatgggtgttccaacacttctg
attgctcgtaccgatgctgatgccgctgatttaattacaagtgatgttgatcctgtagat
cgccagtttattacaggtgaacgcaccgctgaaggtttttatcgcacgagagccggaatc
gatcaagctattgctcgtggcttagcatatgcgccatatgctgatctagtatggtgtgaa
acgtctgaaccaaacttggaacaagcacaaaaatttgcagatgctattcatgaaaaattc
ccaggtaaaatgcttgcttataactgttcaccatctttcaactggaagaaaaaattagat
aagaaaacgattgaaaagttccaaagagaaatcgcaaaaatgggctacaaattccaattc
gttacgcttgctggcttccatgctttaaatcacagcatgtttgagctggcacgaggatat
aaaacaagaggaatggcagcttattcagagttacaagagagagagtttgctagtgaaata
aatggatatactgctacaagacatcagcgtgaagtaggaacgggttattttgatgaagtg
gcgcaagtagtttctggtgggacttcctctaccacagctttaaaaggttcaacggaagaa
gagcagtttcaggcacataaataa

DBGET integrated database retrieval system