KEGG   Bacillus megaterium WSH-002: BMWSH_4969Help
Entry
BMWSH_4969        CDS       T01890                                 

Gene name
dck
Definition
Deoxynucleoside kinase family protein
Orthology
K15519  
deoxyadenosine/deoxycytidine kinase [EC:2.7.1.76 2.7.1.74]
Organism
bmh  Bacillus megaterium WSH-002
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:bmh00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:bmh00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4747379..4748059
Genome map
AA seq 226 aa AA seqDB search
MVNLRSKYNIPNDAVLTIAGTVGVGKSTMTQSLADALQFRTSFEKVDSNPYLDKFYGDFE
RWSFHLQVYFLAERFKEQKKIFEYGGGFIQDRSIYEDTGIFAKMHFEKGTMSKVDYETYT
SLFDAMVMTPYFPHPDLLIYLEGSFEDIVDRIQERGRPMEQQTPLDYWKEMHARYEDWIN
NFTACPILRLDIREYDLIKDPDSIESIVEKVARFLQHNEKLKRRHL
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atggtaaacttacgatcgaaatacaacattcctaatgatgctgtgttgacgatagcgggt
acagttggagttgggaaatctacaatgactcaatcattggctgatgctctccaatttcgc
acatcgtttgaaaaagtagattccaacccttacttggacaaattttatggggattttgaa
cgttggagcttccacctacaagtatattttctagcggaacgctttaaagaacaaaagaaa
attttcgagtatggcggcggcttcatccaagacagatccatttacgaagataccggtatc
tttgctaagatgcattttgaaaaaggaacgatgtctaaagtagactatgaaacatataca
agcttgttcgatgcaatggttatgactccatatttccctcatccggatctgctcatttat
ttggaaggcagcttcgaagatattgtagatcgcattcaagaaagagggcgaccaatggaa
caacaaacgcctcttgattattggaaagagatgcacgcccgatacgaagactggattaat
aactttacggcttgtcctattcttcgtttagatattagagaatacgaccttatcaaggat
cctgattcaattgaatcaattgttgaaaaagtggctcgctttttacaacataatgaaaag
ctaaaacgtcgtcatctataa

DBGET integrated database retrieval system