KEGG   Bacillus megaterium WSH-002: BMWSH_5041Help
Entry
BMWSH_5041        CDS       T01890                                 

Definition
(GenBank) Arginase/agmatinase/formimionoglutamate hydrolase arginase family-like protein
  KO
K01476  arginase [EC:3.5.3.1]
Organism
bmh  Bacillus megaterium WSH-002
Pathway
bmh00220  Arginine biosynthesis
bmh00330  Arginine and proline metabolism
bmh01100  Metabolic pathways
bmh01110  Biosynthesis of secondary metabolites
bmh01130  Biosynthesis of antibiotics
bmh01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bmh00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    BMWSH_5041
   00330 Arginine and proline metabolism
    BMWSH_5041
Enzymes [BR:bmh01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     BMWSH_5041
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: AEN91919
UniProt: G2RQ87
Position
complement(4833994..4834893)
Genome map
AA seq 299 aa AA seqDB search
MNKLSIIGVPMDLGQTRRGVDMGPSAIRYAGVIERIENIGYSVEDKGNIEIALAERVHSD
ENTNLKNLKAVADASERLAQTVSDVITNKRFPLVLGGDHSIAIGTLAGVSRHYKNLGVIW
YDAHGDLNTADTSPSGNIHGMPLAASIGVGDEALTRIGGYTPKVKPENIVIIGARSLDEG
EKELIKEKGIKVYTMHEIDRMGMTKIMEETILYLQDKTDGVHLSLDLDGLDPHDAPGVGT
PVIGGISYRESHLAMEMLAESQLITSAEFVEVNPILDERNKTATVAVALMGSLLGEKLV
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgaataagctttcaattattggagtaccgatggatttaggtcaaactcgccgtggggtc
gatatggggccaagtgcgatacgatatgcaggtgtcattgaacgcatcgagaatattggc
tatagtgtagaagataaagggaatattgaaattgccttagctgaacgagtacatagtgat
gaaaatacaaacttaaagaatttaaaagctgtagcagatgctagcgagaggcttgctcag
accgtaagtgatgttattacaaataaaaggtttcctttagtgctagggggagatcacagt
atcgctatcggaacactagcaggagtaagtcgtcattataaaaacttgggcgtgatttgg
tatgatgcacacggagatttgaatacagcagatacgtctccttcaggaaatattcacggt
atgccattggcggcaagtataggtgtaggagacgaagcattgactcgaattggtggttat
acacctaaagttaagcctgaaaatattgtgattatcggagcacgttctttagatgaagga
gaaaaagagctaataaaggaaaaaggcattaaagtgtatacgatgcatgagatagatcga
atgggcatgacaaaaataatggaagaaacaattttatatttgcaggataaaacagatggc
gttcatctatcactcgatttagatggactggatccacatgatgcacctggagtaggaaca
ccagttatcggtggaataagctatagagaaagtcatttagctatggagatgttggcagaa
tctcagctaatcacttctgctgagtttgtggaagtgaatcctattttagatgaacggaat
aaaacagctaccgtagctgttgcattaatgggctcacttttaggagaaaaattagtataa

DBGET integrated database retrieval system