KEGG   Bacillus megaterium WSH-002: BMWSH_5121Help
Entry
BMWSH_5121        CDS       T01890                                 

Gene name
gltX
Definition
glutamyl-tRNA synthetase bacterial/mitochondrial
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
bmh  Bacillus megaterium WSH-002
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:bmh00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4904127..4905602)
Genome map
AA seq 491 aa AA seqDB search
MEVILVMSSEVRVRYAPSPTGHLHIGNARTALFNYLFARNQNGKFIIRIEDTDQKRNIEG
GEESQLRYLKWLGIEWDESIDVGGEYGPYRQSERTEIYQKYTEELLEKGLAYHCYCTSEE
LEKEREEQQANSQMPRYSGKCRNLTAEQRAELEAEGREPSIRFRVPSNTEIKWNDIVKDE
VSFESEGIGDFVIVKKDGTPTYNYAVAIDDYLMKMTHVLRGDDHISNTPKQILVYEALGW
TPPVFGHMTLIVNENRRKLSKRDESIIQFIEQYKELGYLPEALFNFITMLGWSPVGEEEI
FSKEQFIEIFDPARLSKSPALFDTSKLRWMNNQYMKQLDLDEVVALSVPHLVKAGKVEET
RDAETEQWVRDLVALYQEQMSFGAEIVELTEMFFKKEIDYSEEAKAVLGEEQVPEVLKAF
AEEISSLEEFSADEIKAATKAVQKATGQKGKKLFMPIRVATTGETHGPELPKAISLLGKE
TVLARLESIYS
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
ttggaggtcatcttagttatgtcaagcgaagtaagagttcgttatgccccgagtccaact
ggacatcttcatatagggaatgcaagaacagcactatttaattatttatttgcacgaaat
caaaacggtaaatttattatccgtattgaagatacagatcaaaagcgtaatatcgaaggc
ggagaagaaagtcagctgcgctatttaaaatggttaggtattgaatgggatgagagtatc
gacgtaggcggcgagtacggtccttaccgccagtctgaacgtacggaaatctatcaaaaa
tatacggaagaacttcttgaaaaaggattagcttatcactgttactgtacgtcggaagag
cttgaaaaagagcgtgaagaacagcaggcgaacagtcaaatgccgcgctattcaggtaag
tgccgtaacttaacagctgaacagcgtgctgaactagaagcagaaggccgtgagccaagc
attcgcttccgtgttcctagtaacacagaaattaagtggaatgatattgtcaaagatgaa
gtatcatttgagtctgaaggcattggtgatttcgttattgtgaaaaaagacggtacacca
acatataactacgctgtagccattgatgattatctaatgaagatgacgcatgttctacgc
ggagatgaccatatttctaatacaccgaagcaaattcttgtgtatgaagctttaggctgg
acgcctcctgtatttggtcatatgacattaatcgtaaatgaaaatcgtcgcaagctaagt
aaacgtgatgagtcaatcattcagtttattgagcaatataaagaattaggctacttgccg
gaagcactgtttaattttattacaatgcttggctggtcacctgtgggagaagaagaaatc
ttctctaaagaacagtttattgaaatttttgacccagctcgtttatcaaaatctccagca
ctattcgatacaagcaaattacgttggatgaacaaccaatacatgaaacaactggattta
gacgaggtagtagctttatcagttcctcacttagtgaaagctggaaaagttgaagaaacg
cgcgatgcagaaacagaacaatgggtacgtgacttagtcgctctataccaagaacaaatg
agctttggcgctgagattgttgaacttactgaaatgttctttaagaaagaaattgattac
agtgaagaagcaaaagcagtgcttggtgaagagcaagtaccagaagtgctaaaagcattt
gctgaagagatttcttctttagaagaattcagcgctgatgagattaaggcagcaacaaaa
gctgtacaaaaagcaacaggtcaaaaaggtaaaaaactatttatgccaattcgtgtagca
acaacaggcgaaacacacggtccagagcttccaaaagctatttcccttttagggaaagaa
acagttctagctcgtttagaaagcatttatagttaa

DBGET integrated database retrieval system