KEGG   Bacillus megaterium WSH-002: BMWSH_5132Help
Entry
BMWSH_5132        CDS       T01890                                 

Gene name
folK
Definition
7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
bmh  Bacillus megaterium WSH-002
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bmh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BMWSH_5132 (folK)
Enzymes [BR:bmh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     BMWSH_5132 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4922472..4923017)
Genome map
AA seq 181 aa AA seqDB search
MTVEAYIALGSNIENRMEHLKSGVTGLMKHSEVKVVAVSSVYETAPVGYTNQASFLNMVV
KIQTTYSPEQLLDCLQAIEQAAGRKREIVWGPRTLDLDILLYSNEIIHTDRLSVPHPRMF
ERAFVMVPLNELAPSLILPVAEEKVETITTRLSDLKDVKLFREQTTGILDMFENNSNDLH
K
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgacagtagaagcatatattgcattaggatcaaatattgaaaatcgaatggaacatttg
aagtcgggagttactggcttgatgaaacactctgaggttaaggtagtggctgtttcatct
gtttatgaaacggccccggtcggatatacgaatcaagcaagctttttaaacatggtagta
aaaatacaaacaacgtattcaccagagcaacttttagattgtttgcaagccattgaacaa
gcggcaggtcgaaaaagagagattgtatgggggcctagaacccttgatttagatatctta
ctttatagtaatgaaatcattcatacggatagattgagcgtccctcatcctcgaatgttt
gaacgggcgtttgtgatggttcctctaaacgaactagctccatctcttattctccctgta
gcagaagaaaaagttgaaaccatcacaacacgtttatcggatttaaaagatgtaaaatta
tttcgagagcaaacaactggtatactagacatgttcgaaaataatagtaatgatttacat
aagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system