KEGG   Brucella melitensis ATCC 23457: BMEA_A0203Help
Entry
BMEA_A0203        CDS       T00867                                 

Gene name
cysQ
Definition
3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
bmi  Brucella melitensis ATCC 23457
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bmi00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    BMEA_A0203 (cysQ)
Enzymes [BR:bmi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     BMEA_A0203 (cysQ)
Transfer RNA biogenesis [BR:bmi03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    BMEA_A0203 (cysQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:206643..207488
Genome map
AA seq 281 aa AA seqDB search
MKISASPKAGLDGTALRAVLRDAALEAGRSIMKHYVNGCAVQSKKDASPVTEADHAAEAI
ILAALSSACPDVPVVAEEEVAAGRLPDHLGRKFLLVDPLDGTREFLLRNGDFTVNIGLVE
EGAPVLGIVYAPARNLLFIGSDAGAWAMETTPDHGAGQDQRIFARVSPAEKVAVCSRSHL
TPETERFLAENRIASSVSVGSSLKFCILAKGEADIYPRFGPTMEWDTAAGDAVLRAAGGM
TATLDGRPMIYGQRLRAGAAGFANPDFVAYGAGEAPVFTTA
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatttccgcctctccaaaagcaggccttgatggcacagccttgcgagccgtcctt
cgcgacgctgcgcttgaggctggccgcagcatcatgaagcattatgtcaatggatgcgcg
gtgcagagcaagaaggatgcctcgcccgtaaccgaggcggatcacgcagcggaagccatt
attcttgcggccctgtcgtcggcctgccccgatgtgccggtggtggcggaggaagaagtt
gcagcagggcgcttgccggatcatctggggcgcaaattccttctggtcgatccgctggac
ggaacccgggaattcctgctgcgcaacggcgattttacggtcaatatcggccttgtcgaa
gagggcgcgccagtactgggtatcgtctatgcaccggcccgcaatctgctgtttatcggt
agcgatgcgggtgcatgggcaatggaaaccacaccggaccatggcgcaggccaggaccag
cggatttttgcgcgggtttcgcccgccgaaaaagtggctgtctgtagccgctcgcacctg
acgcctgaaaccgaacgatttctcgctgaaaaccgcatcgcaagcagcgtttcggttggt
tcctcgcttaaattctgcattcttgccaagggtgaggcggatatttatccgcgtttcggc
ccgacgatggaatgggacacggcggcgggcgatgcggtgctgcgcgcggcgggcggcatg
accgccactctcgacggcaggccgatgatctatggccagcgcctccgtgcaggggcggcg
ggtttcgccaatcccgatttcgtggcctatggggcgggtgaggcgcctgttttcaccacg
gcctga

DBGET integrated database retrieval system