KEGG   Brucella melitensis ATCC 23457: BMEA_A0797Help
Entry
BMEA_A0797        CDS       T00867                                 

Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
bmi  Brucella melitensis ATCC 23457
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:bmi00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(765841..766878)
Genome map
AA seq 345 aa AA seqDB search
MTDRQSKYLPANISQHVDDVTGSRRLRRMRKADWSRRLVQENHLTVNDLILSFFLTYGSG
VSEPVEAMPGVERYSVDMAVRMAEKAARLGIPAIAPFPREKPEVKTDDGSFVANPDNLIN
RAVRAIKKEVPEIGIITDAALDPFTTHGHDGILRDGEILNDESVAMVVRGALSQAEAGAD
IIAPSDMMDGRVGAVRQALDEHGFSHVPIMSYATKFASAFYGPYRGAIGTQGLLKGDKKT
YYIDPANPEEAVREAEQDIAEGADMLMVKPGLPYLDIIHRLKDEFRLPTFAYQVSGEYAM
IKAAGINGWIDEEKVMMESLLAFKRAGCDGILTYFAMEVAEKLKA
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatcgtcagtccaaatatctgccagccaatatcagccagcacgtcgatgacgta
acgggcagccgccgcctgcgccgcatgcgcaaggccgactggtcgcgcaggctggtgcag
gaaaaccacctgacggtgaacgacctcattctttccttcttcctgacctatggctccggc
gtgagcgagccggtggaagcaatgcccggcgtggaacgttattcggtggatatggccgtg
cgcatggctgaaaaagccgccaggcttggcattccagccatcgcccccttcccgcgcgaa
aagccggaagtgaaaaccgacgacggctccttcgtcgcaaacccggataacctcatcaac
cgtgcggtacgcgccatcaagaaagaagtgccggaaatcggcatcatcaccgatgccgcg
ctggaccccttcaccacacatggccatgacggcattttgcgcgacggagaaattctcaac
gacgaatcggtcgccatggtggtgcgcggcgcgctttcccaggccgaggccggtgcagac
atcatcgccccgtccgacatgatggatggccgtgtgggcgctgtccgccaggcactggac
gagcacggcttcagccatgtgccgatcatgtcctatgcgaccaagtttgcctctgccttt
tacggcccctatcgcggcgccatcggcacgcaaggcctgctgaaaggcgacaagaaaacc
tattacatcgatccggccaaccctgaagaagctgttcgcgaagccgaacaggacattgcc
gagggcgccgacatgctgatggtgaaaccgggcctgccctatctcgatatcatccaccgt
ctgaaggacgaattccgcctgccgaccttcgcctatcaggtatccggcgaatatgcgatg
ataaaggctgccgggatcaatggctggatcgacgaggaaaaggtgatgatggaaagcctg
ctcgccttcaagcgcgcaggctgtgacggaattctgacctatttcgcaatggaagtggct
gaaaagctcaaggcctga

DBGET integrated database retrieval system