KEGG   Brucella melitensis ATCC 23457: BMEA_A0827Help
Entry
BMEA_A0827        CDS       T00867                                 

Gene name
speB
Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
bmi  Brucella melitensis ATCC 23457
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmi00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BMEA_A0827 (speB)
Enzymes [BR:bmi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     BMEA_A0827 (speB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(791404..792354)
Genome map
AA seq 316 aa AA seqDB search
MPSKTIDHAITARSLTSAATDPTHAGVLSFMRRTYSKSLKGAEAVVWGIPFDAAVSNRPG
ARFGPQAIRRASAIFDNDPQYPFERDLFENLAVIDYGDCLLNYGNHTKTPSTIEREAAKI
LKSDAFLLTLGGDHFITWPLLKAHAAKYGPLALVQFDAHQDTWFDDGRRIDHGSFVARTA
RDGIIDPDLSIQIGIRTHAPEDCGIRIIYGHEVEDMPAAAIADAILKRTNGRKAYLTFDI
DCLDPAFAPGTGTPVAGGPSSAKMLSVLRKLTALDFVGADVVEVAPAYDHADITAIAGAT
IAMYYLGLLGERKERR
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgccttcaaagaccatcgaccatgcgatcactgcccgcagcctgaccagtgcggccacc
gacccaacccatgcgggcgtcttgtccttcatgcggcgcacttactccaagtcgctcaaa
ggcgcggaagcagttgtctggggcattcctttcgatgccgccgtttccaaccggcccggc
gcacgcttcggcccgcaggcgatccggcgcgcctcggcgatcttcgacaacgatccgcaa
tatccgttcgagcgtgatcttttcgagaatctcgctgtcatcgattatggcgactgcctg
ctcaactatggcaatcacaccaagacaccctccaccatcgagcgtgaagcagcaaaaatc
ctgaaatccgatgcatttctgctgacgctcggcggcgatcatttcatcacatggccgctt
ctcaaggcccatgccgcaaaatacggccccctcgctctggtgcagttcgatgcgcatcag
gatacatggttcgatgatggcaggcggatcgaccacggctccttcgtggcccgcacggcg
cgcgacggcatcatcgatcccgacctttcgatccagattggcatccgcacgcatgcgccg
gaagattgcggcatcaggatcatttatggccacgaggtcgaggatatgccagcggcggcg
attgccgatgcaatcctgaaacgcaccaatggcaggaaagcctatctgaccttcgacatt
gactgtcttgatccggcttttgcgccgggaaccggcacgccggttgcaggcggcccctcc
tcggcaaagatgctgtctgtcctgcgcaagctgacggctcttgacttcgtgggcgccgat
gtagtcgaggttgcaccggcctatgaccatgccgatataacagccatcgcgggagcgacg
atcgcaatgtattatctgggccttctgggcgaacggaaagaacgacgatga

DBGET integrated database retrieval system