KEGG   Brucella melitensis ATCC 23457: BMEA_A1070Help
Entry
BMEA_A1070        CDS       T00867                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.3.1.77)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
bmi  Brucella melitensis ATCC 23457
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bmi00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1014505..1015344
Genome map
AA seq 279 aa AA seqDB search
MTKEWQLAHERSLHLGKTAIIMGVLNVTPDSFSDGGRYNDLDRAIAAAETMLEEGATIVD
VGGESTRPGATAVDAQTEASRVVPVIRELVRRFDCIISVDTYRASTARLAVEAGAHIVND
VWGLQREPEIAQLARETGAGLVIMHTSRDRLTNPDVIEDQFMFLNRSLKIAGDAGIEPSR
IVLDPGFGFGKERDEDIALMARMSELQAFGLPLLVGTSRKRFVGAMTGQADPRNRDIGTA
ATSVALRLAGADIFRVHNVAFNRDALAVADAILQSNVRI
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaagaatggcagcttgcccatgaacgcagcctccatctcggaaaaaccgccatc
attatgggagtactgaacgttacgccggattctttctcggatggcgggcgttataacgat
cttgatcgtgccatcgccgctgccgaaacgatgctggaggaaggcgcgaccattgtggac
gttgggggcgaatcgacgcgaccgggcgctactgctgtggatgcgcagacagaagccagc
cgtgtggttccggtaatccgggaactggtgaggcgcttcgattgtatcatttccgtggac
acttatcgtgcttctaccgcgcggcttgcggtggaggccggcgcgcatatcgtcaatgat
gtctgggggcttcagcgcgaaccggaaattgcccagcttgccagagaaacgggggcaggg
cttgtcatcatgcatacgagccgcgaccgcctcacgaatcccgacgtgatcgaagatcag
tttatgttcctgaacaggtcgctgaaaattgccggggatgcaggcatcgagccatcgcgc
atcgtgcttgatccgggtttcggcttcggcaaggagcgggatgaagacattgcgttgatg
gcgcgtatgtctgaattgcaggccttcggactccccctgctggtcggtacatcgcgcaag
cggttcgttggcgcaatgacggggcaggccgatccgcggaaccgcgatatcggcacagcg
gctacttccgtggcccttcgcctggcgggagccgacatcttccgtgttcacaatgtcgct
tttaacagagatgcacttgcagttgcggatgctatcctgcaaagcaacgtcaggatctaa

DBGET integrated database retrieval system