KEGG   Brucella melitensis ATCC 23457: BMEA_A1667Help
Entry
BMEA_A1667        CDS       T00867                                 

Gene name
aceA
Definition
(RefSeq) isocitrate lyase (EC:1.14.11.27)
  KO
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
bmi  Brucella melitensis ATCC 23457
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bmi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BMEA_A1667 (aceA)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BMEA_A1667 (aceA)
Enzymes [BR:bmi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     BMEA_A1667 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
I:1582114..1583403
Genome map
AA seq 429 aa AA seqDB search
MTDFYSLIPSAPKGRFDGIERAHTAEDVKRLRGSVEIKYSLAEMGANRLWKLIHEEDFVN
ALGALSGNQAMQMVRAGLKAIYLSGWQVAADANTASAMYPDQSLYPANAGPELAKRINRT
LQRADQIETAEGKGLSVDTWFAPIVADAEAGFGDPLDAFEIMKAYIEAGAAGVHFEDQLA
SEKKCGHLGGKVLIPTAAHIRNLNAARLAADVMGTPTLIVARTDAEAAKLLTSDIDERDQ
PFVDYEAGRTAEGFYQVKNGIEPCIARAIAYAPYCDLIWMETSKPDLAQARRFAEAVHKA
HPGKLLAYNCSPSFNWKKNLDDATIAKFQRELGAMGYKFQFITLAGFHQLNYGMFELARG
YKDRQMAAYSELQQAEFAAEADGYTATKHQREVGTGYFDAVSLAITGGQSSTTAMKESTE
TAQFKPAAE
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgacagatttttacagcctcatcccttcggcacccaagggccgcttcgacggcattgaa
cgtgcgcatacggccgaagacgtgaaaaggctgcgcggttcggtggagataaagtattcg
ctggccgaaatgggtgcaaaccgcctctggaagctgatccacgaggaagatttcgtcaat
gcgctgggcgcgctttccggcaaccaggccatgcagatggttcgcgccgggttgaaggcg
atctacctttccggctggcaggttgcagcagacgccaacacggcatcagccatgtatccc
gaccagtcgctctatccggccaatgccgggccagagcttgcaaagcgcatcaaccgcacg
ctgcaacgcgccgaccagatcgaaaccgccgaaggcaaggggctttcggttgacacatgg
ttcgcgcccatcgtggcggatgccgaggcaggctttggcgacccgctggatgccttcgag
atcatgaaagcctatatcgaggccggtgctgcgggcgttcactttgaagaccagcttgct
tcggaaaagaagtgcggccatctgggcggcaaggttctgatcccgaccgcagcgcacatc
cgcaacctcaacgcggcacgccttgcagccgacgtcatgggcacgccgaccctcatcgtg
gcgcgcacggatgcggaagcagccaagcttctgacgtcggatatcgacgagcgcgaccag
cctttcgtcgattacgaagcaggccgcacggcggaaggcttctatcaggtgaagaatggc
atcgagccatgcatcgcccgtgcgattgcctatgcgccttattgcgatctgatctggatg
gaaacgtccaagcctgatctcgcacaggcccgtcgcttcgcggaagccgtgcacaaggcg
catccgggcaagctgctcgcctataactgctcgccgtcgttcaactggaaaaagaacctc
gacgacgcgacgattgccaagttccagcgcgagctgggcgcgatgggctacaagttccag
ttcatcacgctggctggcttccaccagctcaactacggcatgttcgagctggcacgcggc
tacaaggatcgtcagatggcggcttattccgagctgcaacaggcggaatttgcagccgaa
gccgatggctacacggcaaccaagcaccagcgcgaagtcggcaccggctatttcgatgcc
gtgtcgctcgcaatcaccggcggccagtcttcgaccaccgccatgaaggaatcgaccgaa
accgcacagttcaagccggctgccgagtag

DBGET integrated database retrieval system