KEGG   Brucella melitensis ATCC 23457: BMEA_A1703Help
Entry
BMEA_A1703        CDS       T00867                                 

Gene name
glcB
Definition
malate synthase G
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
bmi  Brucella melitensis ATCC 23457
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bmi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BMEA_A1703 (glcB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BMEA_A1703 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    BMEA_A1703 (glcB)
Enzymes [BR:bmi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     BMEA_A1703 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1616942..1619128
Genome map
AA seq 728 aa AA seqDB search
MGSAEKRNYVEIEGLAVAPELVEFLAKEAAPGTGVEPEKFWKGFAAIIRDLAPKNRALLA
KRDELQARIDAWYKENRDKGYSQADYQQFLKDIGYLLPEGGAFSVSTTNVDPEITHIAGP
QLVVPVMNARYALNAANARWGSLYDALYGTDAISEADGAEKGKGYNPKRGEKVIAWAKNF
LDESAPLSTGKWADVAGLAVNDGKLEIRLTDGSATTLKDESQFKGYNGDAASPTNVLLAK
HNMHVDIVINADHPIGKTDPAHIADVVLESAISTIQDCEDSIAAVDAEDKVAVYRNWLGL
MNGKLEDTFEKNGKQMTRRLNGDRTYTAPDGSTLTLKGRSLMLVRNVGHLMTNPAILDAE
GNEVPEGIMDAAFTSLIALHDIGPNGRHMNSREGSVYIVKPKMHGPEEVAFANEIFTRTE
EMLGMKPNTLKIGIMDEERRTTVNLKEAIRAAKDRVVFINTGFLDRTGDEIHTSMEAGPM
IRKGDMKQAAWIGAYEQWNVDIGLECGLSGHAQIGKGMWAMPDMMAAMLEQKIAHPKAGA
NTAWVPSPTAATLHATHYHKIDVAAVQEKLKSRPRAKLDDILSVPVAVRPNWTPDDIQHE
IDNNAQGILGYVVRWIDQGVGCSKVPDINNVGLMEDRATLRISAQHIANWLYHGVVSEAQ
VMETMKRMAAIVDKQNEGDPLYRPMAADFDKSIAFQAACDLVFKGREQPNGYTEPVLHRR
RLELKQAS
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgggtagcgcagaaaaacgtaactatgtcgagattgaaggcttggctgttgcccctgag
cttgtggaatttctggccaaagaagccgcgcccggcacaggcgtggagccggagaaattc
tggaagggctttgccgccatcattcgcgatctcgcaccaaagaaccgcgccctgctcgcc
aagcgtgacgagcttcaggccaggatcgacgcctggtacaaggaaaaccgcgacaagggc
tacagccaggccgattaccagcagtttctgaaagatatcggctatctcctgccggaaggt
ggagcgttttcggtttcgaccaccaatgtcgatcctgaaatcacccatattgccggtccg
cagcttgtcgtcccggtcatgaatgcgcgctatgcactcaacgccgccaatgcgcgctgg
ggctcgctctatgatgcgctttatggcaccgacgcgatttccgaggccgatggcgcggaa
aagggcaagggctacaatccgaagcgcggtgaaaaggttattgcgtgggcgaagaatttc
ctcgatgaaagcgcaccgctcagcacgggcaaatgggccgatgttgccggtctcgccgtg
aacgacggcaagcttgaaatcaggctgaccgatggttcggcaaccaccttaaaggacgaa
agccagttcaagggctataatggcgatgccgccagcccaacgaatgtgcttcttgccaag
cacaatatgcatgttgatatcgtcatcaatgcagatcacccgatcggcaagaccgatccg
gcgcatattgccgatgtggttctggaatcggccatcagcacgatccaggattgtgaggac
tccattgccgccgtcgatgccgaagacaaggttgccgtctatcgcaactggctcggcctg
atgaatggcaagctggaagacacgttcgagaagaacggcaagcagatgacgcgccgcctc
aatggcgaccgcacctacacggcgccggacggttccacgctgacgctcaagggccgttcc
ttgatgctggtgcgcaatgtcggccacctgatgaccaacccggccattctggacgccgaa
ggcaatgaagtgccggaaggcatcatggatgcagccttcaccagcctgattgcgctgcat
gatatcggccccaatggccgccacatgaattcgcgcgaaggctcggtctatatcgtcaag
ccaaaaatgcatgggccggaagaagtggcattcgcaaatgaaatcttcacccggaccgaa
gaaatgctcggcatgaagccgaatacgctcaaaatcggcatcatggacgaagaacgccgc
acgaccgtcaatctcaaggaggcaatccgcgccgccaaggatcgcgtcgtcttcatcaat
accggcttcctcgaccgcacgggcgacgagatccacacctccatggaagcaggcccgatg
atccgcaagggcgacatgaagcaggctgcgtggatcggcgcctatgaacaatggaatgtc
gatatcggtctggaatgcgggctttccggccatgcgcagatcggcaagggcatgtgggcc
atgcccgacatgatggcggcaatgctggagcagaagatcgcgcatccgaaggccggtgcg
aacaccgcctgggtgccgtcgccgaccgccgccaccttgcacgctacccattaccacaag
atcgatgtagccgccgttcaggaaaagctgaaaagccgtccccgcgccaagctggacgat
atcctgtcggtgccggttgcggtgcgtccgaactggacgccggacgatatccagcacgaa
atcgacaacaatgcacaaggcattctcggctatgtcgtgcgctggatcgatcagggtgtc
ggctgctccaaggtgccggacatcaacaatgtcggcctgatggaagaccgcgcgacgctg
cgcatttccgcgcagcacatcgccaactggctctatcatggcgtcgtgtcagaggcacag
gtgatggaaaccatgaagcgcatggcagccatcgtcgacaagcagaacgaaggcgacccg
ctttatcgcccgatggccgctgattttgacaagtcgattgccttccaggcggcttgcgat
ctggtcttcaagggccgcgaacagccgaacggctacaccgagccggtcctgcatcgccgc
cggctcgaactgaaacaggcttcctga

DBGET integrated database retrieval system