KEGG   Brucella melitensis ATCC 23457: BMEA_A1829Help
Entry
BMEA_A1829        CDS       T00867                                 

Definition
3-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
bmi  Brucella melitensis ATCC 23457
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:bmi00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:bmi00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1726434..1727225
Genome map
AA seq 263 aa AA seqDB search
MTGVSARKTAIVTGSNSGIGLGIAHALAAAGHNVVINSFTDRDEDHALARMLAEEHGANV
IYIAADMSKAEDCRNLIAKTVKVFGNSDILVNNAGIQHVAPVEEFPPEQWDRIIAINLTS
AFHTSAAAIPHMRKAGWGRIINIASAHGLVASPFKSAYVAAKHGIVGFTKTLALELATAK
ITANSICPGYVLTPLVEAQIPDQMKAHHMDRETVIRDVMLDKQPTKEFVTTAQIGAVATF
LASDAAAQINGAAISVDGGWTAE
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgaccggcgtatccgcccgcaaaactgcaattgttaccggatcaaattcagggatcggc
ctcggaatcgcccatgcactggcagccgcggggcataacgtcgtaataaactccttcacc
gaccgggacgaagaccatgcgcttgcccggatgcttgccgaagaacatggtgcgaatgtc
atctatattgccgcggatatgtcgaaagccgaagattgccgcaatctcattgccaaaacc
gtcaaggttttcggcaactccgatattctggtcaataatgcgggcatccagcatgtcgcc
ccggtggaagagtttcctcccgagcaatgggaccgcatcatcgcaatcaacctgacatcg
gccttccacacttctgctgctgccatcccccatatgcgaaaggcgggctggggccgtatc
atcaatattgcctcggcgcatggtctcgtggcttcgccgttcaaatcggcatatgtcgcc
gccaagcacggcattgtcggcttcaccaagacgctggcgctggagcttgccaccgcaaaa
atcaccgccaattccatctgtcccggctatgtgctgacccctctggtggaagcgcagata
cccgaccagatgaaagcccaccacatggaccgtgaaaccgtgatccgcgacgtgatgctg
gataaacagccgacgaaggagtttgtcaccaccgcgcaaatcggggccgttgccactttc
ctcgcaagcgatgcggcagcgcagatcaacggtgcagccatttccgtcgacggcggctgg
acggcagaataa

DBGET integrated database retrieval system