KEGG   Brucella melitensis ATCC 23457: BMEA_A1939Help
Entry
BMEA_A1939        CDS       T00867                                 

Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
bmi  Brucella melitensis ATCC 23457
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bmi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BMEA_A1939
Enzymes [BR:bmi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     BMEA_A1939
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(1838946..1839653)
Genome map
AA seq 235 aa AA seqDB search
MKRVLVTRPEPAAAQTAAKLRAAGYEPVLLPLSRTVALSFTVPDEVFDALTITSANAFRH
IAPERLLPYRTLPLFAVGEGTAKAAQEAGFKHVIEGGGDAVRLAGTMRQALAPTARVLYL
AGRVRQPVFEDEVAANGLSMMVCDVYDTESVMYPPQALSRILGHAPFVAVMLYSGVAAAS
FVEAMRSITPPFDEKTRFLCISARVAAKLPSSWLQQALVSDHPDEKGLFRLFSKL
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgggttcttgttacacggcctgagccggcagcagcgcaaaccgcagcaaagctt
cgcgcggcgggctatgagccagtgcttctgccgttgagccgcaccgtggcgctttccttt
accgttcccgatgaagttttcgacgcgctcaccattacgagcgccaatgcctttcgccat
attgcgccggagcggcttttgccctaccgcacgctgccgctttttgctgtgggtgagggg
acagcgaaggctgcgcaggaggccggttttaaacatgtgatcgagggtgggggcgatgcc
gttcgccttgccgggaccatgcggcaggcgctggcgccaactgcgcgcgtcctttatctt
gccgggcgggttcgccagccggtttttgaagatgaggtggcggcaaatggtctttcaatg
atggtttgcgatgtctacgacactgagtcggtcatgtatccgccgcaggcgctttcccgc
attctcggccatgcgccatttgtcgcggtgatgctttattcaggcgtggcggcggccagt
tttgtcgaagcgatgcgctccattacgccgccattcgatgagaagacgcggtttttatgc
atttcggcgcgggttgcggccaaattgccttccagttggctgcaacaggcgctggtttcg
gatcatccagatgaaaaggggcttttccgcttgttttctaaactttga

DBGET integrated database retrieval system