KEGG   Brucella melitensis ATCC 23457: BMEA_A2168Help
Entry
BMEA_A2168        CDS       T00867                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bmi  Brucella melitensis ATCC 23457
Pathway
bmi00260  Glycine, serine and threonine metabolism
bmi00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bmi01100  Metabolic pathways
bmi01110  Biosynthesis of secondary metabolites
bmi01130  Biosynthesis of antibiotics
bmi01230  Biosynthesis of amino acids
Module
bmi_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bmi00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BMEA_A2168 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BMEA_A2168 (trpA)
Enzymes [BR:bmi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BMEA_A2168 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB ThiG DUF561 Pterin_bind
Motif
Other DBs
NCBI-ProteinID: ACO01814
UniProt: C0RFZ2
Position
I:complement(2051796..2052635)
Genome map
AA seq 279 aa AA seqDB search
MTTRIDTKFAELKAEGRPALVTYFMGGDPDLETALKVMKALPKAGADVIELGMPFSDPMA
DGPAIQAAGLRALNAGQTLAKTLYMAAKFRKEDDTTPIVMMGYYNLIYIYGVERFLTDAK
ASGVDGLIVVDLPSEMDAELCIPAMKAGINFIRLTTPTTDDKRLPKVLHNSSGFVYYVSM
NGITGAAIADTAKVGEAVRHIKKSTDLPICVGFGVKTPEQAAAIATHADGVVVGTAIVNA
IAGELDEKGKVKGDPVAAATRLVHALAESVRATRLEAAQ
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgactactcgcatcgacaccaaattcgccgaactgaaggccgagggccgtccggcgctc
gttacctatttcatgggcggcgatcccgatctggaaaccgcgctgaaggtgatgaaagcc
ctgccgaaagccggcgctgacgtgatcgagcttggtatgcccttctccgacccgatggcg
gatggacccgccattcaggcggctggccttcgcgccctgaacgccggacagacgctggcg
aagacgctttatatggcagcaaaattccgcaaggaagacgatacgaccccgatcgtcatg
atgggctattacaatctgatctatatctatggcgtggagcgttttctgaccgatgccaag
gcatccggcgtggatgggctgatcgttgtcgatcttccttccgaaatggatgccgagctt
tgcattccggcaatgaaggcgggcatcaatttcatccgcctcaccacgccgaccacggac
gacaagcgcctgccgaaagtgctgcataattcatcgggctttgtctattatgtctcgatg
aacggcatcaccggcgcggccattgccgatacggcaaaggtcggcgaagcggttcgccat
atcaagaaaagcaccgacctgccgatctgtgtcggtttcggcgtcaagacgccggaacag
gctgcggcaatcgcaacccatgccgatggcgtcgtcgtgggcacggccattgtcaacgca
attgccggtgaactcgatgaaaagggcaaggtgaagggtgatccggttgccgccgcaacc
cggcttgtccacgctcttgcagagagtgtgcgcgccacacgccttgaagccgcccaataa

DBGET integrated database retrieval system