KEGG   Brucella melitensis ATCC 23457: BMEA_A2244Help
Entry
BMEA_A2244        CDS       T00867                                 

Gene name
mutM
Definition
formamidopyrimidine-DNA glycosylase (EC:2.3.1.65)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
bmi  Brucella melitensis ATCC 23457
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:bmi00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    BMEA_A2244 (mutM)
Enzymes [BR:bmi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     BMEA_A2244 (mutM)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     BMEA_A2244 (mutM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:2123112..2123993
Genome map
AA seq 293 aa AA seqDB search
MPELPEVETVRRGLQPFMEGATVVRVEQNRPDLRFAFPENFAERLSGRRIEALGRRAKYL
TVHLDDGLSIISHLGMSGSFRIEAEDAQGLPGGFHHERSKNSLHDHVVFHLMRPDGASAR
IIYNDPRRFGFMLFAEKGALEEHPLLKDLGVEPTGNLLSGEVLAALFKGRRTPLKAALLD
QRLIAGLGNIYVCEALWRPGLSPMRAAGSVAGEMDVMERLAGAIRSVIAQAIAAGGSSLK
DYIQADGALGYFQHSFSVYGREGKPCRNPACGGTVERVVQSGRSTFFCASCQT
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgccggaactgccagaggtcgaaacggttcgccgtggtctgcaacccttcatggaaggg
gcaaccgttgtgcgggtggagcagaatcggcccgacctgcgctttgcctttcctgaaaat
tttgccgaacgcctttccggcaggcgcatcgaggcgcttggccgccgtgcgaaatatctg
accgtccatctcgatgacgggctttcgatcatcagccatctcggcatgtccggctcgttt
cgcattgaggcggaggatgcgcaaggtttgccgggcgggtttcatcacgagcgctccaag
aacagcctgcatgaccatgtggtctttcacctcatgcgcccggacggtgcgtctgcacgc
attatttataatgatccgcgccgcttcggtttcatgctctttgccgaaaagggcgcgctg
gaggaacatccgctcctgaaagaccttggtgtggagccgaccggcaatctcctgtcgggc
gaggttctggccgcgcttttcaagggacgccgcacgcccctgaaggccgccttgctcgac
cagaggcttatcgcggggcttggcaatatctatgtctgcgaggcgctctggcgcccaggg
ctttcgccgatgcgcgcggcaggctcggttgcaggcgaaatggacgtgatggagcggctt
gccggggccattcgctccgtcattgcgcaggcgattgcagccggaggctccagccttaag
gattacattcaggccgacggtgcgctcggctatttccagcactctttttccgtctatggc
cgcgagggtaagccatgcagaaaccccgcctgcggcggcactgtcgagcgcgtggtgcaa
tctggtcgttcgacttttttctgtgcctcttgccagacatga

DBGET integrated database retrieval system