KEGG   Brucella melitensis ATCC 23457: BMEA_A2245Help
Entry
BMEA_A2245        CDS       T00867                                 

Definition
(GenBank) enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bmi  Brucella melitensis ATCC 23457
Pathway
bmi00071  Fatty acid degradation
bmi00280  Valine, leucine and isoleucine degradation
bmi00281  Geraniol degradation
bmi00310  Lysine degradation
bmi00360  Phenylalanine metabolism
bmi00362  Benzoate degradation
bmi00380  Tryptophan metabolism
bmi00410  beta-Alanine metabolism
bmi00627  Aminobenzoate degradation
bmi00640  Propanoate metabolism
bmi00650  Butanoate metabolism
bmi00903  Limonene and pinene degradation
bmi00930  Caprolactam degradation
bmi01100  Metabolic pathways
bmi01110  Biosynthesis of secondary metabolites
bmi01120  Microbial metabolism in diverse environments
bmi01130  Biosynthesis of antibiotics
bmi01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bmi00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BMEA_A2245
   00650 Butanoate metabolism
    BMEA_A2245
  Lipid metabolism
   00071 Fatty acid degradation
    BMEA_A2245
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BMEA_A2245
   00310 Lysine degradation
    BMEA_A2245
   00360 Phenylalanine metabolism
    BMEA_A2245
   00380 Tryptophan metabolism
    BMEA_A2245
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BMEA_A2245
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BMEA_A2245
   00281 Geraniol degradation
    BMEA_A2245
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BMEA_A2245
   00627 Aminobenzoate degradation
    BMEA_A2245
   00930 Caprolactam degradation
    BMEA_A2245
Enzymes [BR:bmi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BMEA_A2245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49
Motif
Other DBs
NCBI-ProteinID: ACO01888
UniProt: C0RG66
Position
I:2124120..2124893
Genome map
AA seq 257 aa AA seqDB search
MAYETIIVETRDSVGLIRLNRPQALNALNRAVLEELTDALAAFDADGKVGAVVLTGSEKA
FAAGADIKEMQSINFVDAYLQDMFADWQKVDRIRKPIIAAVSGYALGGGCELAMMCDFII
AGSNAKFGQPEITLGAIPGMGGSQRLTRYVGKSKAMDMCLTGRMMDAAEAERCGLVSRVV
APEALLEEALKAAERIASFSRVSVYMAKEAVNRAYETTLDEGLRFERRLFHSLFATEDQK
EGMSAFVDKRTPSFKNR
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggcctatgaaacaatcatcgttgagacgcgtgacagcgttggtctcatccgtctcaac
cgtccgcaggcgctcaacgcgctcaatcgcgccgtgcttgaggagctgaccgatgcgctt
gccgccttcgacgcggatggcaaggtcggcgccgtggtgctgaccggctcggaaaaggct
ttcgccgccggggccgacatcaaggaaatgcagtcgatcaatttcgtcgatgcctatttg
caggacatgttcgccgactggcagaaggtggatcgtatccgcaagccgattatcgcggct
gtttcgggctatgcgctgggcggcggctgcgaactcgccatgatgtgcgatttcatcatc
gcgggcagcaatgcgaaattcggccagccggaaatcacgctgggcgccattcctggcatg
ggcggctcgcagcgcctgacgcgctatgtcggcaagtccaaggctatggatatgtgcctg
acgggccgcatgatggatgcagccgaagcggagcgttgcggccttgtttcccgcgttgtc
gcaccggaggctcttctggaagaggcactgaaagcagccgaacgcatcgcatccttctcg
cgcgtctcggtctatatggccaaggaagcggtcaaccgcgcctatgaaacgacgctggac
gagggcctgcgtttcgagcgccgcctgttccattcgcttttcgcgaccgaagaccagaag
gaaggcatgtccgctttcgttgataaacgtaccccttccttcaagaaccgctga

DBGET integrated database retrieval system