KEGG   Brucella melitensis ATCC 23457: BMEA_B0007Help
Entry
BMEA_B0007        CDS       T00867                                 

Gene name
rbsK
Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
bmi  Brucella melitensis ATCC 23457
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:bmi00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BMEA_B0007 (rbsK)
Enzymes [BR:bmi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     BMEA_B0007 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:2092..3033
Genome map
AA seq 313 aa AA seqDB search
MSHGEAPLKIFVFGSVNVDVSARMAALPRPEQTVNASGYGIGLGGKGANQAVAVAKLGGA
IRFVGAVGHDAFGELALKQMREFGLDTGSVRVIDDVDTGMAIIQVEETGQNTIAVCAGAN
ARCSSADIDAYGADIAKARITLLQREVPHEANLAVAKAVRAAGGTVLLDPAPVGDASQMA
DLIALSDIISPNETEAAEITGIEPTDLASAEAAGRKLLERGPKIVILKLGSRGALLVTAD
EVKHFTPFKVKVVDTVAAGDSFNGGFAVAFSQARPLHDCVRYGSAAGAIAVTRVGAGAAA
PTAREVEELIGRA
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgagccatggagaagccccgttgaagattttcgttttcggcagtgtgaatgtggatgta
agcgcccgaatggctgccctgccgcggccggagcagacggtaaacgcatccggctatggc
atcgggctgggtggcaaaggagccaatcaggcggttgcggtggcaaaacttggcggggca
atccgatttgtcggcgcggtcggccatgatgcctttggcgaactggccttaaagcagatg
cgcgagtttgggctggataccggcagcgtgcgcgtgatcgatgacgtcgatacaggcatg
gcgatcatccaggtggaggaaaccgggcagaacacgattgcggtctgtgctggcgccaat
gcgcgctgctcgtcagccgatattgatgcttatggcgctgatattgccaaggcaaggatt
acgcttttgcagcgcgaagtgccgcatgaagccaatctggccgttgcgaaagccgtgcgg
gcagcgggtggaaccgtcctgctcgacccggccccggtgggggatgcaagccagatggcc
gatcttatcgccctgagcgacatcatttcgcccaacgagacggaagccgctgaaatcacc
ggcattgagccgaccgacctcgcttcggcggaagcggcggggcgcaagcttctggagcgc
ggcccgaagatcgtcatcctcaagcttggaagccgtggcgcgctgctggtaacggcggat
gaggtgaaacacttcacgccgttcaaggtaaaggtggtggatacggttgcagccggtgac
agtttcaacggcggctttgccgttgctttctcgcaggcgcggcccttgcatgattgcgtg
cggtatggttcggcggcgggcgcgattgcggttacgcgggttggcgcaggcgctgccgcg
ccaaccgcgcgtgaggttgaggaactcatcgggcgcgcttga

DBGET integrated database retrieval system