KEGG   Brucella melitensis ATCC 23457: BMEA_B0035Help
Entry
BMEA_B0035        CDS       T00867                                 

Definition
branched-chain alpha-keto acid dehydrogenase subunit E2 (EC:2.1.1.120)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bmi  Brucella melitensis ATCC 23457
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bmi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BMEA_B0035
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BMEA_B0035
   00020 Citrate cycle (TCA cycle)
    BMEA_B0035
   00620 Pyruvate metabolism
    BMEA_B0035
Enzymes [BR:bmi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BMEA_B0035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:30192..31457
Genome map
AA seq 421 aa AA seqDB search
MPVEVVLPALSAGMEDAVIARWLKAEGDAVSKGDLIAEVETDKATMELEAEVDGRIGQLL
VKDGARANVNQVIALLLKEGEDASAMAGFAVGSSPVAVAEAETPVAASPVPAAPAVSAPA
SGEVRHKASPLARRLAAELGVSLDGLAGSGARGRIVRIDVERAAASKPVPVAAAAAPVAA
PAEVSSKAIPVGIGEYEAVPHTSMRRTIARRLLEAKTTVPHFYLNVDCEIDALLALRSQI
NEKREGSARISVNDFVIKASAAALRRVPDANVIWTDEALLKLKDVDIAVAVATEGGLITP
IIRSADQMSLGAISAQMKSLAARARENRLKPEEFQGGGFSISNLSMYGVKSFSAIINPPQ
SAILAVGAGERRPIERNGELAFATMMSVTLSVDHRAVDGALGAQLLAAFKAGIEDPMSLL
V
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgccggttgaagtcgtattgcctgccctttcggcaggaatggaagatgcagtcatcgcg
cgctggctcaaggccgaaggcgacgcggtgagcaagggcgacctgatcgccgaagtcgaa
accgacaaggcgacgatggagcttgaagccgaagtggatggccgcattggccagcttctg
gtgaaggacggtgcgcgcgccaatgtcaatcaggtgatcgccctgcttttgaaggaaggc
gaagatgcttctgcaatggccggatttgcggtcggctccagtcctgtggccgtggcagaa
gccgaaacccctgttgcagcctcgccggtgccagccgcaccagcagtaagcgcgcccgcc
tccggtgaagtgcgccacaaggcttcgccgctcgcccgccgcctggctgcggaactgggc
gtttcgctggacgggcttgcgggaagtggcgcaaggggccgtatcgtacggatcgacgtg
gaacgcgcggccgcctcgaagccggttccggttgccgccgctgccgctccagtcgccgca
cctgcggaagtttcgtcgaaagccattccggttggcatcggcgagtatgaagccgttccg
cacacatccatgcgccgcaccattgcccgccgcctgctggaagccaagacaacggtgccg
catttctatctgaacgtggattgcgagatcgatgcgcttctggcattgcgcagccagatc
aacgagaagcgggaaggttcggcccgtatttccgtcaatgattttgtcatcaaggcttcc
gccgccgccctgcgccgggtgcccgatgccaatgtcatatggacagacgaggcgcttttg
aagctgaaggacgtcgatattgccgttgcggtggcgacggaaggcggccttatcacaccg
attattcgcagtgccgaccagatgagccttggcgctatttcggcgcagatgaagtctctg
gccgcgcgtgcccgcgaaaaccgcctgaagccggaagaattccagggcggtggcttttcg
atttccaatctcagcatgtatggtgtcaaatccttttcggccatcatcaatccgccgcaa
agcgccattctggcggttggcgcgggcgaacgccgcccaatcgaacgcaatggtgagctt
gctttcgccaccatgatgagcgtgacgctttcggttgaccatcgcgcggtcgacggcgcc
ctgggtgcgcaactgctcgcggccttcaaggccggtattgaagatccgatgtctctgctt
gtctag

  All links  
No link information was found.   
DBGET integrated database retrieval system