KEGG   Brucella melitensis ATCC 23457: BMEA_B0075Help
Entry
BMEA_B0075        CDS       T00867                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.1.2.4)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bmi  Brucella melitensis ATCC 23457
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bmi00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BMEA_B0075 (galU)
   00052 Galactose metabolism
    BMEA_B0075 (galU)
   00500 Starch and sucrose metabolism
    BMEA_B0075 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    BMEA_B0075 (galU)
Enzymes [BR:bmi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BMEA_B0075 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:69385..70278
Genome map
AA seq 297 aa AA seqDB search
MSSIRKIRKAVFPVAGLGTRFLPATKSIPKEMLTVVDKPVIQYVVDEAREAGIEHLIFVT
GRNKAVIEDYFDAQVELYSTLAERGKTEELNRLQDLQPQPGTTSFTRQQVPLGLGHAVWC
ARELVGNEPFALLLPDMVMQSKKGCLAEMVELYEQTGGNIIAVQECDPEEAHKYGIVGKG
GAVGNGFEITRMVEKPAKGTAPSNLYINGRYILQPEIFGLLSKQEKGAGNEIQLTDAMLK
LADQQKFYGFDYRGLTFDCGSKAGFIEANVAFALWREDIRPSVEGSIGHLLKTIQPA
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgagttctattcggaaaatccgcaaggcagtctttcccgtcgcaggtcttggaacgcgc
ttcctgcccgcaaccaaatccatcccgaaggaaatgctgacggttgttgacaaacccgtc
atccaatatgtcgtggacgaagcgcgcgaggcgggtattgaacacctgattttcgttacg
gggcgcaacaaggctgtcatcgaggattatttcgatgcgcaggtggagctttattccaca
ctggccgaacgggggaaaaccgaagagttgaaccgcctgcaggatttgcagccgcagccg
ggcaccaccagctttacccgccagcaggtgccgcttggcctcggccacgctgtctggtgt
gcgcgggaactggtgggcaacgaaccttttgcactgcttctgcctgatatggtgatgcag
tcgaaaaagggctgccttgccgaaatggtcgaactttacgaacagaccggcggcaatatc
atcgccgtgcaggaatgcgacccggaagaggcgcataaatacggtatcgtgggcaagggc
ggcgctgtcggcaatggcttcgagattacgcgcatggtcgaaaagccggctaagggcacg
gcgccgtccaatctctatatcaatgggcgctatatcctccagccggagattttcgggctg
ttgagcaagcaggaaaagggtgcgggcaacgaaatccagctgaccgatgccatgctgaag
cttgccgaccagcagaagttctatggcttcgattatcgcgggctgaccttcgattgcggc
tcgaaggcaggcttcattgaggccaatgtggctttcgcactatggcgtgaggatatccgc
ccgtccgtggaaggctccatcggccatctgttgaagacgatccagccagcctga

DBGET integrated database retrieval system