KEGG   Brucella melitensis ATCC 23457: BMEA_B0574Help
Entry
BMEA_B0574        CDS       T00867                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase catalytic subunit (EC:3.6.4.8)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
bmi  Brucella melitensis ATCC 23457
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:bmi00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:bmi00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:564816..565784
Genome map
AA seq 322 aa AA seqDB search
MTNQTVSPLFPHRHLLGIKGLSPLDILCLLDLADQEIAVSRQPEKKKSVLRGRTQINLFF
EASTRTQSSFELAGKRLGADVMNMSVGNSSVKKGETLIDTAMTLNAMQPDILVIRHASAG
AAALLAQKVGCSVVNAGDGAHEHPTQALLDALTIRRAKGQIENLIVAICGDVLHSRVARS
NILLLNALGARVRVVAPSTLLPAGMADMSVEVFNSMEEGLKDADVVMMLRLQRERMAGSF
VPSVREYFHFYGLDREKLKFAKPDALVMHPGPMNRGVEIASDVADGPQSVIQQQVEMGVA
VRMAVMEALLDPRRNPGNGEPA
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgacaaatcaaacggtctctccgcttttccctcaccgccacctgcttggcatcaagggg
ctatcgcccctggacattctctgccttctcgatcttgccgatcaggaaatcgctgtctcc
cggcagccggagaagaaaaagtccgtgctgcgcggtcgcacgcaaatcaacctgttcttt
gaagcatcgacacggacgcaatcttcgttcgagctggccggaaaacggctgggcgcggat
gtgatgaatatgtccgtcggcaattcatcggtcaagaaaggcgaaacgctcatcgatacg
gcgatgacgctgaacgccatgcagccggatattctcgtcatccgccatgcttccgccggt
gctgccgcccttctcgcgcagaaagtgggttgctcggtggtcaatgcgggcgacggcgcg
catgaacaccccacacaggcgcttctcgatgcgctgacaatccgccgcgccaagggccag
atcgaaaatctgatcgtcgccatctgcggtgacgttctgcattcgcgcgtggcgcgctcc
aacattctcctgctcaacgcgctcggcgcgcgggtgcgggtggttgcgccttcaacactc
ctgcccgccggcatggccgatatgagcgtggaagttttcaactccatggaggaggggctg
aaagacgctgatgtcgtcatgatgctgcgcctccagcgcgagcgcatggcgggttccttc
gtgccttccgtgcgggaatatttccatttctatggcctggaccgggaaaaactcaaattc
gccaaacccgatgcacttgtgatgcatccggggccaatgaaccggggcgtcgagattgcc
tccgacgttgcggacgggccgcaaagcgtcatccagcaacaggtggaaatgggcgttgcc
gtgcgcatggccgtgatggaggctctgctcgatccgcggcgcaacccaggcaacggagaa
ccggcatga

DBGET integrated database retrieval system