KEGG   Brucella melitensis ATCC 23457: BMEA_B0809Help
Entry
BMEA_B0809        CDS       T00867                                 

Definition
2-nitropropane dioxygenase NPD
Orthology
K00459  
nitronate monooxygenase [EC:1.13.12.16]
Organism
bmi  Brucella melitensis ATCC 23457
Pathway
Nitrogen metabolism
Brite
KEGG Orthology (KO) [BR:bmi00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    BMEA_B0809
Enzymes [BR:bmi01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.12  With incorporation of one atom of oxygen (internal monooxygenases or internal mixed-function oxidases)
    1.13.12.16  nitronate monooxygenase
     BMEA_B0809
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:796043..797011
Genome map
AA seq 322 aa AA seqDB search
MALPDILKDRLRIPVVGAPLFIISHPALVLAQCKAGVVGSFPALNARPEAQLDEWLAEIT
EDLAAYNAVNPGRPAAPFAVNQIVHRSNKRLEHDLGLCVKYKVPIVISSLGAVPEVNAAI
HSYGGIVLHDVINNRHANSAIRKGADGLIAVAAGAGGHAGSLSPFALIQEIRSWFDGPLL
LSGAIANGRSILAAQAMGADLAYMGSPFIATTEARAVDAYKQMIVDSDSSDIVYSNYFTG
IAGNYLKPSIAKAGLDPDNLPQADPSKMDFEKAQQEGAKAWKDIWGCGQGIAAIKEIAPT
ASLVDRLEREYRDARAKLCAGA
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atggccttgccggatatattgaaagacagattgcgcattcccgttgtaggcgctcccctt
ttcatcatttcccatccggctctggtgctggcgcaatgcaaggcgggcgtcgttggctcc
ttccctgccctcaatgcgcgccccgaggcacagcttgatgaatggctggcagagattacc
gaagatctggcagcctataacgccgtcaatcccgggcgcccggctgctcctttcgcggtc
aaccagatcgtacatcgctccaacaagcgcctggaacatgatcttggcctgtgtgtgaaa
tacaaggtgccgatcgttatttcctcgctcggtgccgtgccggaagtgaacgccgcgatc
cattcctatggcggcatcgtgctgcatgacgtcatcaacaatcgccatgcaaattctgca
atccgcaagggtgctgatggtctcatcgcggttgcggctggcgccgggggccatgcaggc
tcactttcgcccttcgcactcattcaggaaatccgctcatggttcgatggcccgctgctt
ctttcgggcgcgatcgccaatggccgttcaattcttgccgcgcaggccatgggtgccgac
ctcgcttatatgggttcaccgttcatcgcgacgacggaagcccgcgcggttgacgcctat
aagcagatgatcgtcgattcagactcctccgacatcgtctactccaattacttcacgggc
attgcaggcaattatttgaaaccctccattgccaaggctggtcttgaccctgacaacttg
ccgcaagccgacccatcgaaaatggatttcgagaaggcccagcaggaaggcgcaaaagcc
tggaaggatatctggggctgtggccagggcattgctgcgatcaaggaaatcgccccgacg
gcctcactggtggatcgtctggaacgcgaatatcgcgacgcacgcgcaaagctctgcgct
ggcgcttga

DBGET integrated database retrieval system