KEGG   Brucella melitensis ATCC 23457: BMEA_B0809Help
Entry
BMEA_B0809        CDS       T00867                                 

Definition
2-nitropropane dioxygenase NPD
Orthology
K00459  
nitronate monooxygenase [EC:1.13.12.16]
Organism
bmi  Brucella melitensis ATCC 23457
Pathway
Nitrogen metabolism
Class
Metabolism; Energy metabolism; Nitrogen metabolism [PATH:bmi00910]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:796043..797011
Genome map
AA seq 322 aa AA seqDB search
MALPDILKDRLRIPVVGAPLFIISHPALVLAQCKAGVVGSFPALNARPEAQLDEWLAEIT
EDLAAYNAVNPGRPAAPFAVNQIVHRSNKRLEHDLGLCVKYKVPIVISSLGAVPEVNAAI
HSYGGIVLHDVINNRHANSAIRKGADGLIAVAAGAGGHAGSLSPFALIQEIRSWFDGPLL
LSGAIANGRSILAAQAMGADLAYMGSPFIATTEARAVDAYKQMIVDSDSSDIVYSNYFTG
IAGNYLKPSIAKAGLDPDNLPQADPSKMDFEKAQQEGAKAWKDIWGCGQGIAAIKEIAPT
ASLVDRLEREYRDARAKLCAGA
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atggccttgccggatatattgaaagacagattgcgcattcccgttgtaggcgctcccctt
ttcatcatttcccatccggctctggtgctggcgcaatgcaaggcgggcgtcgttggctcc
ttccctgccctcaatgcgcgccccgaggcacagcttgatgaatggctggcagagattacc
gaagatctggcagcctataacgccgtcaatcccgggcgcccggctgctcctttcgcggtc
aaccagatcgtacatcgctccaacaagcgcctggaacatgatcttggcctgtgtgtgaaa
tacaaggtgccgatcgttatttcctcgctcggtgccgtgccggaagtgaacgccgcgatc
cattcctatggcggcatcgtgctgcatgacgtcatcaacaatcgccatgcaaattctgca
atccgcaagggtgctgatggtctcatcgcggttgcggctggcgccgggggccatgcaggc
tcactttcgcccttcgcactcattcaggaaatccgctcatggttcgatggcccgctgctt
ctttcgggcgcgatcgccaatggccgttcaattcttgccgcgcaggccatgggtgccgac
ctcgcttatatgggttcaccgttcatcgcgacgacggaagcccgcgcggttgacgcctat
aagcagatgatcgtcgattcagactcctccgacatcgtctactccaattacttcacgggc
attgcaggcaattatttgaaaccctccattgccaaggctggtcttgaccctgacaacttg
ccgcaagccgacccatcgaaaatggatttcgagaaggcccagcaggaaggcgcaaaagcc
tggaaggatatctggggctgtggccagggcattgctgcgatcaaggaaatcgccccgacg
gcctcactggtggatcgtctggaacgcgaatatcgcgacgcacgcgcaaagctctgcgct
ggcgcttga

DBGET integrated database retrieval system