KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_00042Help
Entry
BMULJ_00042       CDS       T00740                                 

Gene name
res
Definition
type III restriction enzyme (EC:3.1.21.5)
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:42382..45408
Genome map
AA seq 1008 aa AA seqDB search
MRLHFEADLDYQRDAIDAVCDLFRGQESYRGDFSVLASAAPGTTAAAQGSLGFAMSERGV
GNRLSLTDDALARNLADVQLRGGLPPSGSPGSRDFTVEMETGTGKTYVYLRTIFELNRRY
GFTKFVIVVPSIAIKEGVHKTLSITEDHFRALYAGVPYDYFLYDSAKLGQVRHFAASATI
QIMVMTVAAINKKEVNNLYKDSEKTGGEKPIDLIRATRPIVIVDEPQSVDGGLEGRGREA
LAAMDPLCTLRYSATHVDRHHMVYRLDAVDAYERKLVKQIEIASAIVEDAHNKPYVRLVG
VSNRRGAISARLELDVATANGVKRQLVSATDGDDLERLTKRALYAGLRIGEVHAVKGAEY
VELRHPEGETFLSLGEAFGDIDTLAVQREMIRRTIREHLDKELRLAERGVKVLSLFFVDS
VERYRRYDENGMPVKGEYALIFEEEYARAARVPAYRALFDGVDIAREVERAHNGYFSIDR
KGGWTDTSESSAVARENAERAYGLIMREKEALLSFDTPLKFIFSHSALKEGWDNPNVFQI
CTLRDIQTERERRQTLGRGLRLAVDQDGERVRDPGVNTLTVIATERYESFAENLQKEIEA
DTGIRFGIVEQHQFAALPVQEGDGPAHALGIELSRVLWTHLHEQGYVDAQGKVLDRLKDA
LRQSALVLPDAFESLRAPIVATLRKLSGRFAVRNADERRAIALRRDASGKAVVFGDDFRA
LWDRIRHRTVYRVDFDNAKLVRDCAAALRDAPDIARARLQWRKAEIDIGKSGVEAIEVGG
AGTVLIDEGELPLPDLLTELQDRTQLTRRSLATILADSGRLDDFRVNPQQFIAIAADAIN
RCKRLALVAGIAYRKLGDRHVHALESFESEALTGYLRNLRLEARKSIHEAVVCETDAERA
FADALEAHDGVKLYAKLPAWFRVATPLGSYHPDWAVLAEQDDGERLYFVVDTPNADGDTP
TEHERAKLACGEAHFRALADGDDAARFVRVRHVDALFDAAAAPARTAR
NT seq 3027 nt NT seq  +upstreamnt  +downstreamnt
atgcggctgcacttcgaagcggacctcgactatcagcgcgacgcgatcgacgccgtctgc
gacctgtttcgcggccaggaatcgtatcgcggcgacttcagcgtgctcgcgagcgcggcg
cccggcacgacggccgccgcgcaaggctcgctcggcttcgcgatgtcggagcgcggcgtc
ggcaaccggctgtcgctgaccgacgacgcgctcgcgcgcaacctcgccgacgtgcagctg
cgcggcgggctgccgccgtccggctcgccgggctcgcgcgacttcacggtcgagatggaa
accggcaccggcaagacttacgtgtatctgcgcacgatcttcgagctgaaccgccgctac
ggcttcacgaagttcgtgatcgtcgtgccgtcgatcgcgatcaaggaaggcgtgcacaag
acgctctcgatcaccgaggatcacttccgcgcgctctacgcgggcgtgccttacgactac
ttcctgtacgactccgccaagctcggccaggtgcgccacttcgccgcgagcgcgacgatc
cagatcatggtgatgacggtcgccgcgatcaacaagaaggaagtcaacaacctctacaag
gacagcgagaagaccggcggcgagaaaccgatcgacctgatccgcgcgacgcggccgatc
gtgatcgtcgacgagccgcagagcgtcgacggcgggctcgaagggcgcggccgcgaggcg
ctggccgcgatggacccgctctgcacgctgcgctattcggccacgcacgtcgaccgtcat
cacatggtgtaccggctcgatgcggtcgacgcgtacgagcgcaagctcgtcaagcagatc
gagatcgcatcggcgatcgtcgaggatgcgcacaacaagccgtacgtgcggctcgtcggc
gtgtcgaaccggcgcggcgcgatcagtgcgcgtctcgagctcgacgtcgcgaccgcgaac
ggcgtgaagcgccagctcgtgtcggccaccgacggcgacgatctcgaacgcctgacgaag
cgcgcgctctacgcggggctgcgcatcggcgaggtgcatgcggtgaagggcgccgagtac
gtcgagctgcggcatccggaaggcgaaacgttcctgtcgctcggcgaggcgttcggcgac
atcgacacgctcgccgtgcagcgcgagatgatccgtcgcacgatccgcgagcatctggac
aaggagctgcgcctcgccgagcgcggcgtgaaagtgctgtcgctgttcttcgtcgattcg
gtcgaacggtatcggcgctacgacgagaacgggatgcccgtcaaaggtgaatacgcgctg
atcttcgaagaggaatacgcgcgcgcggcgcgcgtgcccgcgtatcgcgcgctgttcgac
ggcgtcgacatcgcgcgcgaggtcgaacgtgcgcacaacggctacttctcgatcgaccgc
aagggcggctggaccgacacgagcgaaagcagcgccgtcgcgcgcgagaacgccgaacgc
gcgtacgggctcatcatgcgcgagaaggaagcgttgctgtcgttcgacacgccgctgaag
ttcatcttctcgcactcggcgctcaaggaaggctgggacaaccccaacgtattccagatc
tgcacgctgcgcgacatccagaccgagcgcgaacgccgccagacgctcggccgcgggctg
cgtctcgcggtcgaccaggacggcgagcgcgtgcgcgatccgggcgtcaacacgttgacc
gtgatcgcgaccgagcgctacgagtcgttcgcggagaacctgcagaaggaaatcgaggcc
gacaccggcatccgcttcgggatcgtcgagcagcaccagttcgccgcgctgcccgtgcag
gaaggcgacgggcccgcgcatgcgctcggcatcgaactgtcgcgcgtgctgtggacgcat
ctgcacgaacaaggctacgtcgacgcgcagggcaaggtgctcgaccggctgaaggacgcg
ctgcggcaaagcgcgctcgtgctgcccgacgcgttcgagtcgctgcgcgcgccgatcgtc
gcgacgctgcgcaagctgtcaggccgcttcgcagtgcgcaatgccgacgagcgccgcgca
atcgcgctgcggcgcgatgcatcgggcaaggccgtcgtgttcggtgacgatttccgcgcg
ctgtgggatcgcatccgccatcgcaccgtctatcgcgtcgatttcgacaatgcgaagctc
gtgcgcgactgcgcggccgcgctgcgcgacgcgcccgacatcgcacgcgcacgcctgcaa
tggcgcaaggccgagatcgacatcggcaagtcgggcgtcgaggcgatcgaggtcggcggc
gccggcaccgtgctgatcgacgagggcgaactgccgctgcccgacctgctcaccgaattg
caggaccgcacgcagctcacgcgccgctcgctggcgacgatccttgcggacagcggccgg
ctcgacgatttccgcgtgaatccgcagcagttcatcgcgatcgcggccgatgcgatcaat
cgctgcaagcggctcgcgctcgtcgcgggcatcgcgtaccggaaactcggcgatcgccac
gtccacgcgctcgaatcgttcgagagcgaggcgctgaccggctatctgcgcaacctgcgg
ctcgaggcgcgcaagtcgatccacgaggccgtcgtctgcgagaccgacgcggagcgcgca
ttcgcggacgcgctcgaggcgcacgacggcgtgaagctgtatgcgaagctgcccgcgtgg
ttccgcgtcgcgacgccgctcggcagctatcacccggactgggcggtgctcgccgagcag
gacgacggcgagcggctgtacttcgtcgtcgatacgccgaatgcggacggcgatacgccg
accgagcacgagcgcgcgaagctcgcctgcggcgaagcgcatttccgtgcgctggccgat
ggcgacgatgcggcgcggttcgtgcgcgtccggcacgtcgacgcgctgttcgacgccgct
gcggcgccggcgcgcacggcgcggtaa

DBGET integrated database retrieval system