KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_00370Help
Entry
BMULJ_00370       CDS       T00740                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
Pathway
bmj00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bmj01100  Metabolic pathways
bmj01110  Biosynthesis of secondary metabolites
bmj01130  Biosynthesis of antibiotics
bmj01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bmj00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BMULJ_00370 (trpC)
Enzymes [BR:bmj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     BMULJ_00370 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C
Motif
Other DBs
NCBI-ProteinID: BAG42343
UniProt: A9AJ43
Position
1:complement(396340..397125)
Genome map
AA seq 261 aa AA seqDB search
MSDILDRIIAVKREEVAAAMRSTPLEALKLEASARDRRDFVGALRAKHAAGQPAVIAEIK
KASPSKGVLREHFVPADIARSYAAHGAACLSVLTDEQFFQGSVRYLEEARAACDLPVLRK
DFIVDAYQILEARAMGADAILLIAAALDTPLMQELEAYAHSLDLAVLVEVHDRNEMEQAL
TLKTPLLGINNRNLRTFETSIRATLDMLDMIPQDRIVVTESGILSRADVDTMRAANVNTF
LVGEAFMRADQPGEELARMFF
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacattctcgaccgaatcatcgccgtcaagcgcgaagaagtagccgccgccatg
cgcagcacgccgctcgaggcgctgaagctggaagcgtccgcacgcgaccggcgcgacttc
gtcggcgcgctgcgcgccaagcatgcggccggccagccggccgtgatcgccgaaatcaag
aaggcgagcccgtcgaagggcgtgctgcgcgagcatttcgtgccggccgacatcgcgcgc
tcgtacgcggcgcacggcgccgcgtgcctgtcggtgctgaccgacgagcagttcttccag
ggcagcgtccgctatctcgaggaagcgcgcgccgcgtgcgacctgccggtgctgcgcaag
gacttcatcgtcgacgcgtaccagatcctcgaagcgcgcgcgatgggcgcggacgcgatc
ctgctgatcgccgccgcgctcgacacgccgctgatgcaggagctcgaagcgtatgcgcac
tcgctcgatctcgcggtgctcgtcgaagtgcacgaccgcaacgaaatggagcaggcgctg
acgctcaagacgccgctgctcggcatcaacaaccgcaacctgcgcacgttcgaaacctcg
atccgggcgacgctcgacatgctcgacatgattccgcaggaccgcatcgtcgtgaccgaa
tcggggatcctgtcgcgcgcggacgtcgatacgatgcgcgcggcgaacgtcaacacgttc
ctcgtcggcgaggcgttcatgcgtgccgaccagccgggcgaggaactcgcacggatgttc
ttctga

DBGET integrated database retrieval system