KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_00484Help
Entry
BMULJ_00484       CDS       T00740                                 

Definition
ribonuclease T1 (EC:3.1.27.3)
Orthology
K01167  
ribonuclease T1 [EC:3.1.27.3]
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:519690..520121
Genome map
AA seq 143 aa AA seqDB search
MARKWLRNGALASVFAMFAMGIVGTPTGSLVSAAYARQTVSADVAAGGFDTIPTARLPRE
AVTTLGLIAAGGPYPYEKDGIVFGNRERILPKAKRGYYHEYTVPTPRARNRGARRIVCGG
PLRRIDNCYYTDDHYNSFKRIVE
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atggcacgcaagtggctccgcaacggcgcgctcgcgtccgtcttcgcgatgttcgcgatg
ggtatcgtcggcacgccgacgggcagtctggtttccgccgcctacgcacggcagaccgtt
tcggccgatgtggccgccggcgggttcgatacgatcccgaccgcccgtctgccgcgcgag
gccgtgaccacgctcggcctgatcgctgccggcggtccctatccgtacgagaaagacggc
atcgtgttcggcaaccgcgagcggatcctgccgaaggcgaagcgcggctactaccacgag
tacacggtgccgacgccgcgcgcgcgcaatcgcggcgcgcgccggatcgtctgcggcggg
ccattgcggcggatcgacaactgttattacacggacgaccactacaacagttttaaacgt
attgttgaatga

DBGET integrated database retrieval system