KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_00484Help
Entry
BMULJ_00484       CDS       T00740                                 

Definition
ribonuclease T1 (EC:3.1.27.3)
Orthology
K01167  
ribonuclease T1 [EC:3.1.27.3]
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
Brite
Enzymes [BR:bmj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.27  Endoribonucleases producing 3'-phosphomonoesters
    3.1.27.3  ribonuclease T1
     BMULJ_00484
Messenger RNA biogenesis [BR:bmj03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Ribonucreases
     BMULJ_00484
Transfer RNA biogenesis [BR:bmj03016]
 Eukaryotic Type
  3'processing and CCA adding factors
   3'processing factor
    BMULJ_00484
 Prokaryotic Type
    BMULJ_00484
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:519690..520121
Genome map
AA seq 143 aa AA seqDB search
MARKWLRNGALASVFAMFAMGIVGTPTGSLVSAAYARQTVSADVAAGGFDTIPTARLPRE
AVTTLGLIAAGGPYPYEKDGIVFGNRERILPKAKRGYYHEYTVPTPRARNRGARRIVCGG
PLRRIDNCYYTDDHYNSFKRIVE
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atggcacgcaagtggctccgcaacggcgcgctcgcgtccgtcttcgcgatgttcgcgatg
ggtatcgtcggcacgccgacgggcagtctggtttccgccgcctacgcacggcagaccgtt
tcggccgatgtggccgccggcgggttcgatacgatcccgaccgcccgtctgccgcgcgag
gccgtgaccacgctcggcctgatcgctgccggcggtccctatccgtacgagaaagacggc
atcgtgttcggcaaccgcgagcggatcctgccgaaggcgaagcgcggctactaccacgag
tacacggtgccgacgccgcgcgcgcgcaatcgcggcgcgcgccggatcgtctgcggcggg
ccattgcggcggatcgacaactgttattacacggacgaccactacaacagttttaaacgt
attgttgaatga

DBGET integrated database retrieval system