KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_00610Help
Entry
BMULJ_00610       CDS       T00740                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bmj00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(660542..661081)
Genome map
AA seq 179 aa AA seqDB search
MTVAYLGLGANLGDARQTLKDAVVCLAQQRTITILDKSSLYRTAPIDAGGDDYYNCVVKV
DTTLAARELLALCQKIEHHFGRERPYRNAPRTLDIDILLFGADSIDEADLIVPHPRLTER
AFALVPLVEIEPLLDIPARGRADAFLAAVAHQRIEKVQTCQCLMKALAAGDGADKNRCR
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgacggttgcatatctcgggctcggcgcaaatctcggcgatgcgcgccagaccctgaag
gacgcggtggtgtgtctcgcgcagcagcgcaccatcacgattctcgacaagtcgagcctg
taccgcaccgcgccgatcgatgcgggcggcgacgactactacaactgcgtcgtcaaggtc
gacacgacgctcgccgcccgcgagctgctcgcgctctgccagaagatcgaacatcacttc
ggccgcgaacgtccgtaccgcaacgcgccgcgcacgctcgacatcgacatcctgctgttc
ggcgccgattcgatcgacgaagccgacctgatcgtcccgcatccgcgcctgaccgagcgc
gccttcgcgctcgtgccgctcgtcgagatcgagccgctgctcgacattccggcgcgcggc
cgcgccgacgcattcctcgctgcggtcgcgcaccagcgcatcgagaaggtgcagacctgt
cagtgcctgatgaaggcgctcgccgccggcgacggcgccgacaagaaccgctgccgatga

DBGET integrated database retrieval system