KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_00610Help
Entry
BMULJ_00610       CDS       T00740                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmj00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BMULJ_00610 (folK)
Enzymes [BR:bmj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     BMULJ_00610 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(660542..661081)
Genome map
AA seq 179 aa AA seqDB search
MTVAYLGLGANLGDARQTLKDAVVCLAQQRTITILDKSSLYRTAPIDAGGDDYYNCVVKV
DTTLAARELLALCQKIEHHFGRERPYRNAPRTLDIDILLFGADSIDEADLIVPHPRLTER
AFALVPLVEIEPLLDIPARGRADAFLAAVAHQRIEKVQTCQCLMKALAAGDGADKNRCR
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgacggttgcatatctcgggctcggcgcaaatctcggcgatgcgcgccagaccctgaag
gacgcggtggtgtgtctcgcgcagcagcgcaccatcacgattctcgacaagtcgagcctg
taccgcaccgcgccgatcgatgcgggcggcgacgactactacaactgcgtcgtcaaggtc
gacacgacgctcgccgcccgcgagctgctcgcgctctgccagaagatcgaacatcacttc
ggccgcgaacgtccgtaccgcaacgcgccgcgcacgctcgacatcgacatcctgctgttc
ggcgccgattcgatcgacgaagccgacctgatcgtcccgcatccgcgcctgaccgagcgc
gccttcgcgctcgtgccgctcgtcgagatcgagccgctgctcgacattccggcgcgcggc
cgcgccgacgcattcctcgctgcggtcgcgcaccagcgcatcgagaaggtgcagacctgt
cagtgcctgatgaaggcgctcgccgccggcgacggcgccgacaagaaccgctgccgatga

DBGET integrated database retrieval system