KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_00739Help
Entry
BMULJ_00739       CDS       T00740                                 

Gene name
manB
Definition
phosphomannomutase (EC:5.4.2.8)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bmj00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BMULJ_00739 (manB)
   00030 Pentose phosphate pathway
    BMULJ_00739 (manB)
   00051 Fructose and mannose metabolism
    BMULJ_00739 (manB)
   00052 Galactose metabolism
    BMULJ_00739 (manB)
   00500 Starch and sucrose metabolism
    BMULJ_00739 (manB)
   00520 Amino sugar and nucleotide sugar metabolism
    BMULJ_00739 (manB)
  Nucleotide metabolism
   00230 Purine metabolism
    BMULJ_00739 (manB)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BMULJ_00739 (manB)
Enzymes [BR:bmj01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     BMULJ_00739 (manB)
    5.4.2.8  phosphomannomutase
     BMULJ_00739 (manB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:811899..813293
Genome map
AA seq 464 aa AA seqDB search
MISQSIFKAYDIRGVVGKTLDADTARSIGRAFGSEVRAQGGDAVVVARDGRLSGPELVGA
LADGLRAAGVDVVDIGMVPTPVGYFAASVPLALKGGERRVDSCIVVTGSHNPPDYNGFKM
VLRGAAIYGEQIQALYRRIVDERFESGSGTYEEHDVADAYIDRIVGDVKLARPLKLVVDA
GNGVAGPLATRLFKALGCTLVERFTDIDGTFPNHHPDPAHPENLQDVIQALKDTDAELGF
AFDGDGDRLGVVTKDGQIIYPDRQLMLFAEEVLSRNPGAQIIYDVKCTRHLAQWVKSKGG
EPLMWKTGHSLVKAKLRETGAPLAGEMSGHVFFKDRWYGFDDGLYTGARLLEILAKTADP
SAVLNALPDAMSTPELQLKLEEGENFSLIEKLQKEAKFDGADEVVTIDGLRVEYPDGFGL
ARSSNTTPVVVLRFEAETQDGLKRIQDDFRRVLTAAKPDVKLPF
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgatctcccaatccatcttcaaggcatatgacatccgcggcgtggtcggcaagacgctc
gacgccgacacggcgcgcagcatcggccgcgcgttcggcagcgaagtgcgcgcgcagggc
ggcgacgcggtcgtcgtcgcgcgcgacggccgcctgtccgggcccgagctcgtcggcgcg
ctcgccgacgggctgcgtgcggcaggcgtcgacgtcgtcgacatcggcatggtcccgacg
ccggtcggctacttcgcggcgagcgtgccgctcgcgctgaagggcggcgagcgccgcgtc
gattcgtgcatcgtcgtcaccggcagccacaacccgcccgactacaacggcttcaagatg
gtgctgcgcggcgcggcgatctacggcgagcagatccaggcgctgtatcgccgcatcgtc
gacgagcgcttcgagagcggcagcggcacgtacgaagagcacgacgtggccgacgcgtac
atcgaccgcatcgtcggcgacgtgaagctcgcgcgcccgctgaagctcgtcgtcgacgcg
ggcaacggcgttgccggtccgcttgcgacgcgcctgttcaaggcgctcggctgcacgctg
gtcgagcgcttcaccgacatcgacggcacgttcccgaaccatcaccccgatccggcccac
ccggaaaacctgcaggacgtgatccaggcgctgaaggacacggacgccgagctcggcttc
gcgttcgacggcgacggcgaccgtctcggcgtcgtcacgaaggacggccagatcatctat
ccggatcgccagctgatgctgttcgccgaggaagtgctgtcgcgcaacccgggcgcgcag
atcatctacgacgtgaagtgcacgcgccacctcgcgcaatgggtgaagtcgaagggcggc
gagccgctgatgtggaagacgggccactcgctcgtgaaggcgaagctgcgcgaaacgggc
gcgccgctcgcgggcgaaatgagcggccacgtgttcttcaaggatcgctggtacggcttc
gacgacggcctctacacgggcgcgcgcctgctcgagatcctcgcgaagacggccgacccg
agcgccgtgctgaacgcgctgcccgatgcgatgagcacgccggaactgcagctgaagctc
gaggaaggcgagaacttcagcctgatcgagaagctgcagaaggaagcgaagttcgacggc
gcggacgaagtcgtgacgatcgacggcctgcgtgtcgagtatccggacggcttcgggctc
gcgcgttcgtcgaacacgacgccggtcgtcgtgctgcgcttcgaggccgagacgcaggac
ggcctgaagcgcattcaggacgacttccgccgtgtgctgacggccgcgaagccggacgtg
aagctgccgttctga

DBGET integrated database retrieval system