KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_00739Help
Entry
BMULJ_00739       CDS       T00740                                 

Gene name
manB
Definition
(GenBank) phosphomannomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
Pathway
bmj00010  Glycolysis / Gluconeogenesis
bmj00030  Pentose phosphate pathway
bmj00051  Fructose and mannose metabolism
bmj00052  Galactose metabolism
bmj00230  Purine metabolism
bmj00500  Starch and sucrose metabolism
bmj00520  Amino sugar and nucleotide sugar metabolism
bmj00521  Streptomycin biosynthesis
bmj01100  Metabolic pathways
bmj01110  Biosynthesis of secondary metabolites
bmj01120  Microbial metabolism in diverse environments
bmj01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bmj00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BMULJ_00739 (manB)
   00030 Pentose phosphate pathway
    BMULJ_00739 (manB)
   00051 Fructose and mannose metabolism
    BMULJ_00739 (manB)
   00052 Galactose metabolism
    BMULJ_00739 (manB)
   00500 Starch and sucrose metabolism
    BMULJ_00739 (manB)
   00520 Amino sugar and nucleotide sugar metabolism
    BMULJ_00739 (manB)
  Nucleotide metabolism
   00230 Purine metabolism
    BMULJ_00739 (manB)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BMULJ_00739 (manB)
Enzymes [BR:bmj01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     BMULJ_00739 (manB)
    5.4.2.8  phosphomannomutase
     BMULJ_00739 (manB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: BAG42700
UniProt: A0A0H3KHG2
Position
1:811899..813293
Genome map
AA seq 464 aa AA seqDB search
MISQSIFKAYDIRGVVGKTLDADTARSIGRAFGSEVRAQGGDAVVVARDGRLSGPELVGA
LADGLRAAGVDVVDIGMVPTPVGYFAASVPLALKGGERRVDSCIVVTGSHNPPDYNGFKM
VLRGAAIYGEQIQALYRRIVDERFESGSGTYEEHDVADAYIDRIVGDVKLARPLKLVVDA
GNGVAGPLATRLFKALGCTLVERFTDIDGTFPNHHPDPAHPENLQDVIQALKDTDAELGF
AFDGDGDRLGVVTKDGQIIYPDRQLMLFAEEVLSRNPGAQIIYDVKCTRHLAQWVKSKGG
EPLMWKTGHSLVKAKLRETGAPLAGEMSGHVFFKDRWYGFDDGLYTGARLLEILAKTADP
SAVLNALPDAMSTPELQLKLEEGENFSLIEKLQKEAKFDGADEVVTIDGLRVEYPDGFGL
ARSSNTTPVVVLRFEAETQDGLKRIQDDFRRVLTAAKPDVKLPF
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgatctcccaatccatcttcaaggcatatgacatccgcggcgtggtcggcaagacgctc
gacgccgacacggcgcgcagcatcggccgcgcgttcggcagcgaagtgcgcgcgcagggc
ggcgacgcggtcgtcgtcgcgcgcgacggccgcctgtccgggcccgagctcgtcggcgcg
ctcgccgacgggctgcgtgcggcaggcgtcgacgtcgtcgacatcggcatggtcccgacg
ccggtcggctacttcgcggcgagcgtgccgctcgcgctgaagggcggcgagcgccgcgtc
gattcgtgcatcgtcgtcaccggcagccacaacccgcccgactacaacggcttcaagatg
gtgctgcgcggcgcggcgatctacggcgagcagatccaggcgctgtatcgccgcatcgtc
gacgagcgcttcgagagcggcagcggcacgtacgaagagcacgacgtggccgacgcgtac
atcgaccgcatcgtcggcgacgtgaagctcgcgcgcccgctgaagctcgtcgtcgacgcg
ggcaacggcgttgccggtccgcttgcgacgcgcctgttcaaggcgctcggctgcacgctg
gtcgagcgcttcaccgacatcgacggcacgttcccgaaccatcaccccgatccggcccac
ccggaaaacctgcaggacgtgatccaggcgctgaaggacacggacgccgagctcggcttc
gcgttcgacggcgacggcgaccgtctcggcgtcgtcacgaaggacggccagatcatctat
ccggatcgccagctgatgctgttcgccgaggaagtgctgtcgcgcaacccgggcgcgcag
atcatctacgacgtgaagtgcacgcgccacctcgcgcaatgggtgaagtcgaagggcggc
gagccgctgatgtggaagacgggccactcgctcgtgaaggcgaagctgcgcgaaacgggc
gcgccgctcgcgggcgaaatgagcggccacgtgttcttcaaggatcgctggtacggcttc
gacgacggcctctacacgggcgcgcgcctgctcgagatcctcgcgaagacggccgacccg
agcgccgtgctgaacgcgctgcccgatgcgatgagcacgccggaactgcagctgaagctc
gaggaaggcgagaacttcagcctgatcgagaagctgcagaaggaagcgaagttcgacggc
gcggacgaagtcgtgacgatcgacggcctgcgtgtcgagtatccggacggcttcgggctc
gcgcgttcgtcgaacacgacgccggtcgtcgtgctgcgcttcgaggccgagacgcaggac
ggcctgaagcgcattcaggacgacttccgccgtgtgctgacggccgcgaagccggacgtg
aagctgccgttctga

DBGET integrated database retrieval system