KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_00757Help
Entry
BMULJ_00757       CDS       T00740                                 

Gene name
pcm
Definition
(GenBank) protein-L-isoaspartate (D-aspartate) O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
Brite
Enzymes [BR:bmj01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     BMULJ_00757 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_25 RrnaAD PrmA MTS Methyltransf_31 Met_10 Methyltransf_11 Methyltransf_12 Methyltransf_18 Methyltransf_23 Spermine_synth Ubie_methyltran Methyltransf_32 TPMT Methyltr_RsmB-F Glucokinase Eno-Rase_NADH_b
Motif
Other DBs
NCBI-ProteinID: BAG42718
UniProt: A0A0H3KCM5
Position
1:complement(830321..830974)
Genome map
AA seq 217 aa AA seqDB search
MNIEKARFNMIEQQIRPWDVLDLDVLGLLSIVKRENFVPAEYRDLAFADLELPLPGGRKM
LFPRVEARVLQELAVKKHENVLVIGAGSGYLTALIAHRALHVTAVEIDPTIAKFAADNLR
ENAVTNAEVVLGDGSLGWPDKAPYDVICVAGGLPVVPQQMLEQLKIGGRLSAFVGGRPVM
KAQVITRIDEKQYRVADVFETYVDHLVNAMEPSRFKF
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgaatatcgaaaaagcgcgtttcaacatgatcgaacagcagatccggccgtgggacgtg
ctggatctggacgtcctgggcctgctgtcgatcgtcaagcgtgagaatttcgttccggcc
gaataccgcgatctcgcgttcgccgatcttgaactgccgctgcccggcggccgcaagatg
ctgttcccgcgcgtcgaagcgcgcgtgctgcaggaactggccgtcaagaagcacgagaac
gtgctcgtgatcggcgcgggctccggctacctgaccgcgctgatcgcacaccgcgcgctg
cacgtcacggcggtcgagatcgacccgacgatcgcgaagttcgcggccgacaacctgcgc
gagaacgccgtgacgaacgcggaagtcgtgctcggcgacggttcgctcggctggcccgac
aaggcgccgtacgacgtgatctgcgtcgcgggcggcctgccggtcgtgccgcagcagatg
ctcgaacagctgaagatcggcggccgcctgtcggcgttcgtcggcggccggccggtaatg
aaggcgcaggtgatcacgcgcatcgacgagaagcagtatcgcgtcgcggacgtgttcgaa
acctacgtcgaccacctcgtcaacgcgatggaaccgtcgcgcttcaagttctga

DBGET integrated database retrieval system