KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_00800Help
Entry
BMULJ_00800       CDS       T00740                                 

Gene name
glk
Definition
bifunctional glucokinase/RpiR family transcriptional regulator (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bmj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BMULJ_00800 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BMULJ_00800 (glk)
   00052 Galactose metabolism
    BMULJ_00800 (glk)
   00500 Starch and sucrose metabolism
    BMULJ_00800 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    BMULJ_00800 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BMULJ_00800 (glk)
   00524 Butirosin and neomycin biosynthesis
    BMULJ_00800 (glk)
Enzymes [BR:bmj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     BMULJ_00800 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(875348..877276)
Genome map
AA seq 642 aa AA seqDB search
MSTGAQSKAVVAGQHADGPRLLADVGGTNARFALETGPGEITQIRVYPGADYPTLTDAIR
KYLKDVKISRVNHAAIAIANPVDGDQVTMTNHDWSFSIEATRRALGFDTLLVVNDFTALA
MALPGLTDAQRVQIGGGTRRQNSVIGLLGPGTGLGVSGLIPADDRWIALGSEGGHASFAP
QDEREDLVLQYARKKFPHVSFERVCAGPGIEIIYRALAARDKKRVAANVDTAEVVERAHA
GDALALETVECFCGILGSFAGSVALTLGALGGVYIGGGVALKLGELFTRSSFRARFEAKG
RFTHYLQNIPTYLITAEYPAFLGVSAILAEQLSNRSGGASSAVFERIRQMRDALTPAERR
VADLALNHPRSIINDPIVDIARKADVSQPTVIRFCRSLGCQGLSDFKLKLATGLTGTIPM
SHSQVHLGDTATDFGAKVLDNTVSAILQLREHLNFEHVENAIEILNGARRIEFYGLGNSN
IVAQDAHYKFFRFGIPTIAYGDLYMQAASAALLGKGDVIVAVSKSGRAPELLRVLEVAMQ
AGAKVIAITSSNTPLAKRATVALETDHIEMRESQLSMISRILHLLMIDILAVGVAIRRAS
PNDALPEALAQAKARANDEETADVLDWLSHGASPAAKDVARD
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atgtctactggtgcgcaaagtaaggccgtcgtcgcgggccagcatgccgacggcccgcgc
ctgctcgcggacgtcggcggcaccaacgcgcgcttcgcgctggagaccgggccgggcgag
atcacgcagatccgcgtgtatcccggcgccgattacccgacgctcaccgatgcgatccgc
aaatacctgaaggacgtgaagatcagccgcgtgaaccatgcggcgatcgcgatcgcgaat
ccggtcgacggcgatcaggtgacgatgacgaaccacgactggagcttctcgatcgaggcg
acgcgccgcgcgctcggcttcgatacgctgctcgtcgtcaacgacttcacggcgctcgcg
atggcgctgccgggcctgaccgacgcgcagcgcgtgcagatcggcggcggcacgcgccgc
cagaacagcgtgatcgggctgctcgggcccggcacggggctcggcgtatcgggcctgatt
cctgccgacgatcgctggatcgcgctcggcagcgaaggcggccacgcatcgttcgccccg
caggacgaacgcgaggatctcgtgctgcagtacgcgcgcaagaagtttccgcacgtgtcg
ttcgagcgcgtctgcgcggggcccggcatcgagatcatctatcgcgcgctcgccgcgcgc
gacaagaagcgcgtcgccgcgaacgtcgataccgccgaagtcgtcgagcgcgcgcatgcg
ggcgatgcgctcgcgctcgagacggtcgaatgcttctgcggcatcctcggctcgttcgcg
ggcagcgtcgcgctgacgctcggcgcgctcggcggcgtctatatcggcggcggcgtcgcg
ctgaagctcggcgaactgttcacgcgctcgtcgttccgcgcgcgcttcgaggcgaagggc
cgcttcacgcactatctgcagaacatcccgacctacctgatcaccgccgaatatccggcg
ttcctcggcgtgtcggcgattctcgcggagcagctgtcgaaccgctcgggcggcgcatcg
tcggccgtgttcgagcggatccgccagatgcgcgacgcgctgacgccggccgaacgccgc
gtcgccgatctcgcgctgaaccatccgcgctcgatcatcaacgatccgatcgtcgacatc
gcgcgcaaggccgacgtgagccagccgaccgtgatccgcttctgccgctcgctcggctgc
caggggctatccgacttcaagctgaagctcgcgaccgggctcaccggcacgattccgatg
agccacagccaggtgcatctcggcgacacggcgaccgacttcggcgcgaaggtgctcgac
aacacggtgtccgcgatcctgcagctgcgcgagcatctgaatttcgagcatgtcgagaac
gcaatcgagatcctgaacggcgcgcgccgcatcgagttctacgggctcggcaactcgaac
atcgtcgcgcaggacgcgcattacaagttcttccgcttcggcattccgacgatcgcgtac
ggcgacctgtacatgcaggctgcctccgcggcgctgctcggcaagggcgacgtgatcgtc
gcggtatcgaaatcgggacgcgcgcccgagctgctgcgcgtgctcgaggtggcgatgcag
gcgggcgcgaaggtgatcgcgatcacgtcgagcaatacgccgctcgcgaagcgcgcgacc
gtcgcgctcgagaccgatcacatcgagatgcgcgagtcgcagctgtcgatgatctcgcgg
atcctgcatctgctgatgatcgacatcctcgcggtcggcgtcgcgatccgccgcgcatcg
ccgaacgacgcgctacccgaagcgctcgcgcaggcgaaggcgcgcgcgaacgacgaggaa
acggccgacgtgctcgactggctcagccacggcgcgtcgccggccgcgaaggacgtcgcg
cgcgactga

DBGET integrated database retrieval system