KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_00835Help
Entry
BMULJ_00835       CDS       T00740                                 

Gene name
gmk
Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:bmj00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:909098..909781
Genome map
AA seq 227 aa AA seqDB search
MTESTRDGHASHSLHGGVYPGNLFMVVAPSGAGKSTLVNALLSKDSDIRLSISYTTRKPR
PGEQDGQHYHFTTVEDFRARHAAHEFLESAEVHGNYYGTSRVWIEEQMKSGHDVLLEIDW
QGAQQVKKQFRNAVGIFILPPSLDALEERLKKRGQDEPNVITRRLLAAGSEMAHASEAEY
VVINENFDRALAELECIVAATRLRFASQYARHTELFIELGIHLPHAE
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaatccacccgcgacggccacgcgtcgcattcactgcacggcggcgtttatccc
ggcaacctgttcatggtcgtcgcgccgtcgggcgccggcaagtcgacgctcgtgaatgcg
ctgctgtcgaaggacagcgacatccgcctgtcgatctcgtacacgacgcgcaagccgcgt
ccgggcgagcaggacggccagcactatcatttcacgacggtcgaggatttccgtgcgcgc
cacgcggcgcacgaattcctcgaaagcgcggaagtgcacggcaactactacggcacgtcg
cgcgtctggatcgaagagcagatgaagagcggccacgacgtgctgctcgagatcgactgg
cagggcgcgcagcaggtgaagaagcagttccgcaacgcggtcggcatcttcattctgccg
ccgtcgctcgacgcgctcgaggagcggctgaaaaagcgcggccaggacgagccgaacgtg
atcacgcgacgcctgctcgcggcgggcagcgagatggcgcacgcgtccgaagccgagtac
gtcgtgatcaacgagaacttcgatcgtgcgctcgcggagctcgaatgcatcgtcgcggcg
acgcgtctgcgctttgcgtcgcagtacgcgcggcacacggagctgttcatcgaactcggt
atccatctgccccacgcggaatga

DBGET integrated database retrieval system