KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_00931Help
Entry
BMULJ_00931       CDS       T00740                                 

Definition
lysozyme (EC:3.2.1.17)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
Brite
Enzymes [BR:bmj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     BMULJ_00931
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1000527..1000991
Genome map
AA seq 154 aa AA seqDB search
MIAVPQAAIELAKRFEGFHRVPKHDPNRAYPYICPAGYWTIGYGHLCDPKHPPITETDAE
RYLAADLMTALNATLRYCPVLATEPEKRLAAIVDFTFNLGAGRLQTSTLRRRINQRDWHS
AGQELRRWVYGGGKVLPGLVTRREAEATCLLRAA
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
gtgattgcggtaccccaagcggccatcgagctggccaaacgcttcgagggcttccaccgc
gttccaaagcacgatcccaaccgcgcctatccgtacatctgtccggccggctactggacc
atcggctacggccacctctgcgatccgaagcacccaccgatcacggagaccgacgcagag
cgctacctggctgccgacctcatgacggcattgaacgcgacgctgcgctactgcccggtg
ctggccaccgagccagaaaagcgactcgcggccatcgtcgacttcaccttcaacctcggc
gcggggcgacttcaaacgtcgacgctgcggcggcggataaaccagcgggactggcatagt
gcgggccaagagctgcggcgctgggtgtatggcggtggcaaggtactgccggggcttgtc
acgcggcgagaggccgaggcgacttgcctgctccgcgccgcctga

DBGET integrated database retrieval system