KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_01076Help
Entry
BMULJ_01076       CDS       T00740                                 

Gene name
nagZ
Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bmj00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BMULJ_01076 (nagZ)
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    BMULJ_01076 (nagZ)
Enzymes [BR:bmj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     BMULJ_01076 (nagZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1141482..1142510
Genome map
AA seq 342 aa AA seqDB search
MKTTPGPVMLDVVGTALSRDDARRLAHPNTGGVILFARHFQNRAQLTALTDAIRAVRDDI
LIAVDHEGGRVQRFRTDGFTVLPAMRRLGELWDRDVLLATKVATAVGYILAAELRACGID
MSFTPVLDLDYGQSQVIGDRAFHRDPRVVTLLAKSLNHGLALAGMANCGKHFPGHGFAEA
DSHVALPTDDRPLETILAQDVAPYDWLGLSLSAVIPAHVIYTQVDARPAGFSRVWLQDIL
RGRLGFTGAIFSDDLSMEAAREGGTLTQAADAALAAGCDMVLVCNQPEAAEVVLNELKAE
RNADSARRIKRMRARGKALKWDKLIEQPEYRRAQALLADALR
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgactcccggcccggtcatgctcgacgtcgtcggcacggccctgtcacgcgac
gatgcgcggcgtctcgcgcatccgaacaccggcggcgtgatcctgttcgcgcggcacttt
cagaaccgcgcgcaactgaccgcgctgaccgatgcgatccgcgcagtgcgcgacgatatc
ctgatcgcggtcgatcacgaaggcgggcgcgtgcagcgcttccgcaccgacggcttcacg
gtgctgccggcgatgcgccgcctcggcgagctatgggatcgcgacgtgctgctcgcgacg
aaagtggcgaccgcggtcggctacatccttgccgccgagctgcgcgcgtgcgggatcgac
atgagctttacgccggtgctcgacctcgactacggtcagtcgcaggtgatcggcgatcgg
gcgttccatcgcgatccgcgcgtcgtcacgctgctcgcgaagagcctcaatcacgggctt
gcgctcgccggcatggcgaactgcggcaagcatttccccggccacggcttcgcggaagcg
gactcgcacgtcgcgctgccgaccgacgaccgtccgctcgagacgatcctcgcacaggac
gtcgcgccgtacgactggctcggcctgtcgttgtcggccgtgattcccgcgcacgtgatc
tatacgcaggtcgacgcgcgcccggccggcttctcgcgcgtctggctgcaggacatcctg
cgcggccggctcggctttaccggcgcgatcttcagcgacgatctgtcgatggaagccgcg
cgcgagggcggcacgctgacgcaggccgccgacgcggcgctcgccgccggctgcgacatg
gtgctcgtgtgcaatcagccggaagcggccgaagtggtcctgaacgagctgaaggccgag
cgcaatgccgattccgcacggcgcatcaagcggatgcgcgcacgcggcaaggcgctcaag
tgggacaagctgatcgagcagcccgagtatcggcgcgcgcaggcgctgctggccgacgcg
ctccgataa

DBGET integrated database retrieval system