KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_01157Help
Entry
BMULJ_01157       CDS       T00740                                 

Gene name
recD
Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bmj00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BMULJ_01157 (recD)
Enzymes [BR:bmj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     BMULJ_01157 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1238869..1241193
Genome map
AA seq 774 aa AA seqDB search
MNVSDDTLEFTGGLVARLPEPADFGIALAEGFARRIGDLARRAGAPAEAARWAARAAFAT
SRATAAGHVCVSLGALAQRYEATLDDVRAALAASGVVAFGTLVRGDERPLIVDRHDHLYL
SRYFDYERRLADALVAQAGVARADDALSPERLRENLTRYFGPATGEVDWQRVAAIVALTG
RVTIVSGGPGTGKTTTVVGVLACLLDAHPTLRVALAAPTGKAAQRMQEALHARAGDLPPE
LAARLPDTSYTLHRLLGGGGASGFRHHRDNPLPYDLIVVDEASMIDVALAAHLLDALAPG
ARLVLLGDKDQLAAVEAGAVFAELSARPTFTAAARTRISQALGIDEAAFAAALPVPDDEA
SENGATSAASAAPPVAPPPTSPAVAARKTTRKRTVDVRQASLFDDEPQDDGATAADSDSS
PRPSTDATNATNATDPHDDAPAWIEGDELAWLDAAVLPPLDANAVALASTPAAAASARIE
ATAPPPAASAHASAPAPLADCVVWLERNYRFGLDSPIGRLSLAIRRGDVQAALDALPADD
AAAASFYEDAGDTLAAATIDRLARRFDAYLDALRTALAAPAPDPLPLFDALNRFRVLCAT
RNGSRGAEHVNALVAAQVRRAARVPLAVGAHWFTGRPIMVTRNDYALGLFNGDIGIALPD
ANGVLRVWFRRADDTARAVSPAALPPHETAFALTVHKSQGSEFDEAALVLPASFGRVLTR
ELVYTAVTRARARVQVIGSRHVLAQAVAARTQRDSGLSARVDEALARRRAEATR
NT seq 2325 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtgtccgacgatacgctcgaattcaccggcggccttgtcgcgcggctgcccgag
ccggcggacttcggcatcgcgctcgcggagggcttcgcgcgccggatcggcgatctcgcg
cggcgcgcgggcgcaccggccgaggccgcgcgctgggccgcacgcgcggccttcgcgacg
agccgcgcgaccgcggccggtcacgtctgcgtgtcgctcggcgcgctcgcgcagcgctac
gaggcgacgctcgacgacgtgcgcgcggcgctcgcggcaagcggcgtcgtcgcgttcggc
acgctcgtgcgcggcgacgagcggccgctgatcgtcgaccggcacgatcatctgtatctg
tcgcgctatttcgactacgaacggcgtcttgccgatgcgctcgtcgcgcaggccggcgtc
gcgcgcgcggacgatgcgctgtcgcccgagcgcctgcgcgagaacctgacacgctatttc
ggtccggcgaccggcgaagtcgactggcagcgtgtcgcggcgatcgtcgcgctgacgggc
cgcgtgacgatcgtcagcggcgggccgggcaccgggaagacgacgaccgtcgtcggcgtg
ctggcctgtctgctcgacgcgcatccgacgctgcgcgttgcgctcgccgcgccgaccggc
aaggccgcgcagcgcatgcaggaagcgctgcacgcgcgtgccggcgacttgccgcccgag
ctggcggcgcggctgcccgacacgtcgtacacgctgcaccggctgctcggcggcggcggt
gcgtcgggctttcgccatcatcgcgacaacccgttgccgtacgacctgatcgtcgtcgac
gaagcgtcgatgatcgacgtcgcgctggccgcgcatctgctcgatgcgctcgcgcccggc
gcgcggctcgtgctgctcggcgacaaggatcagcttgcggcggtcgaggcgggcgcggtg
ttcgcggaattgagcgcacggccgacgtttaccgccgccgcacgcacgcgcatttcgcag
gcgctggggatcgacgaagcggcgttcgcagcggcattgccggtgccggacgatgaggcg
agtgagaacggagcgacgtcggcagcgtcggcagcgccacccgtggcgccgccgccgacg
tcgcccgctgtcgccgcgcgcaagacgacacgcaagcgaacggtcgatgtgcggcaagcg
tcgctgttcgacgacgagccgcaggacgatggcgcgacggcggccgacagcgactcctcg
ccacgaccgtccaccgacgctaccaatgccaccaacgccacggacccgcacgacgacgcc
cccgcgtggatcgagggcgacgaactcgcatggctcgatgcagccgtgctgccgccgctc
gacgcgaacgcggtggcgcttgcttcgacgccggcagcagcggcgtccgcacgcatcgaa
gcgaccgcaccgccgcccgccgcgtccgcgcatgcgtccgcgcccgcgccactcgccgac
tgcgtcgtctggctcgaacgcaattaccggttcgggctcgattcgccgatcggccggctg
tcgctggcgatccgccgcggcgacgtgcaggccgcgctcgatgcgttgcccgccgacgac
gcggccgccgcgtccttttacgaagatgcgggtgacacgctcgccgcggcgacgatcgac
cggctcgcgcggcggttcgacgcctatctcgacgcgctgcgcacggcgctggccgcgccc
gctcccgatccgctgccgctgttcgacgcactcaaccggttccgggtcctctgcgcgacg
cgcaacggctcgcgcggcgcggaacacgtgaacgcgctcgtcgccgcgcaggtgcggcgc
gccgcgcgcgtgccgctcgcggtcggtgcgcattggttcacggggcggccgatcatggtc
acgcgcaacgactacgcgctcggcctcttcaacggcgatatcgggatcgcgctgcccgat
gcgaacggcgtgctgcgcgtgtggttccgccgcgcggacgacaccgcgcgcgcggtgtcg
cctgccgcgctgccgccgcacgagacggcgtttgcgctgacggtccacaagtcgcagggc
tccgagttcgacgaggccgcgctcgtgctgccggcatcgttcggtcgcgtgctgacgcgc
gagctcgtctataccgcggtcacgcgtgcgcgcgcgcgcgtgcaggtgatcggctcgcgg
cacgtgctcgcgcaggcagtcgcggcccgcacgcagcgcgattcgggcctgtcggcgcgc
gtcgacgaagcgctcgcgcgacgtcgcgctgaggcaacgcgatga

DBGET integrated database retrieval system