KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_01221Help
Entry
BMULJ_01221       CDS       T00740                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmj00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BMULJ_01221 (folP)
Enzymes [BR:bmj01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     BMULJ_01221 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1308145..1309038
Genome map
AA seq 297 aa AA seqDB search
MSDSTAFPSIPAPLRCGRFTLTFERPLVMGILNATPDSFSDGGRFLAYDDAVRQAERMIA
DGADILDIGGESTRPGAPPVPLDEELARVIPLVEALRPLNVPLSIDTYKPAVMRAALAAG
ADLINDIWGFRQPGAIDAVRDGDSGLCAMHMLGEPQTMQVGEPDYGDVVADVRDFLAARA
QALRDAGVAPERICVDPGFGFGKAVVDDNYALLAALPDTAPLRPDGRAYPVLAGMSRKSM
LGAVIGGKPPMERIAASVAAALCAVERGAAIVRVHDVAATVDALKVWCAVREAARQR
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
gtgtccgattccaccgctttcccgtccattcccgcgccgctgcgttgcggccgcttcacg
ctgaccttcgaacgcccgctcgtgatgggcatcctgaacgcgacgcccgattcgttttcc
gacggcggccgttttctcgcctacgacgacgcagtgcgacaagccgaacggatgattgcc
gacggcgccgacatactcgatatcggcggcgaatcgacgcgtcccggtgcgccgcccgtg
ccgctcgatgaagagctcgcacgcgtgatcccgctcgtcgaagcgctgcggccgctcaac
gtgccgttgtcgatcgacacgtacaagccggcggtcatgcgcgcggcgctcgcggccggt
gcggacttgatcaacgacatctggggtttccgtcagccgggcgcgatcgacgccgtgcgc
gacggcgacagcggactctgtgcgatgcacatgctcggcgagccgcagacgatgcaggtc
ggcgagcccgattacggcgacgtcgtcgcggacgtgcgcgattttctcgcggcgcgcgcg
caggcgctgcgcgacgccggcgtcgcgccggaacggatttgcgtcgatcccggtttcggg
ttcggcaaggcagtcgtcgacgacaactatgcgctgctggccgcgctgcccgacacggcg
ccgctgcggcccgacggacgcgcgtatccggtactcgccgggatgtcgcgcaagtcgatg
ctcggcgcggtgatcggcggcaagccgccgatggagcggatcgcggcgagtgtcgccgcc
gcgttgtgcgcggtcgagcgcggcgccgcgatcgtgcgcgtgcacgacgtcgcggcgacg
gtcgacgcgctgaaagtatggtgtgccgtgcgcgaagccgcgcggcaacgataa

DBGET integrated database retrieval system